CAZyme Information: MGYG000004781_00157

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680
• CAZyme ID: MGYG000004781_00157
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000004781_1|CGC3	47840.53	9.637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004781	3497015	MAG	China	Asia

• Gene Location: Start: 147242; End: 148444 Strand: -

Full Sequence      

MKKRIKNICKKIMKAIYRLMVKVFPVSKDIILFESNLGKNYTGNPKAIYERMVELGLDKK
YRIVWVFNNPKQPIPGNAKKVKRVRFQYFYYCAVAKVWVFDCRHPRYLIKRKENLYIQTW
HGTPLKKLALDMEVIDMGGVKDIDHYRAEFKKNSSVWDCLISQNRFSTETFRRCFAFNKR
MLEVGYPRNDVLFSGNTKENIINLKKKYNIPLDKKVILYAPTWRDNEYGEGKKYKFATAL
DFKKAKEALEDEYIMIVKYHYLIADKVDWSGTEGFVYSFKADQEISELYLISDMMITDYS
SVMFDYSLLKRPMFFFAYDFENYRENLRGFYFDMLEEVPGPVSKTTEQLIFDIKNYKKED
WEQKYQAYAEKFNGVDDGNASLHVIEVMEEHMQKKRIREQ

Enzyme Prediction     

No EC number prediction in MGYG000004781_00157.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	5.50e-120	25	381	1	351	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.47e-79	2	390	1	386	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ10349.1	4.63e-121	10	386	329	701
QHS23522.1	1.11e-119	16	385	336	705
QHQ80528.1	1.31e-116	17	385	359	723
QYG90226.1	2.54e-116	17	385	358	722
ADP34069.1	2.54e-116	17	385	358	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	3.94e-101	14	384	338	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	4.27e-100	14	384	338	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.19e-99	14	384	338	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLM5	1.79e-100	14	384	338	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	4.84e-99	2	385	345	739	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	6.44e-98	23	386	26	390	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	9.12e-85	27	388	26	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKJ2	4.74e-33	22	386	251	601	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004781_00157.