CAZyme Information: MGYG000004781_00349

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680
• CAZyme ID: MGYG000004781_00349
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590	MGYG000004781_2|CGC2	65902.51	4.8061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004781	3497015	MAG	China	Asia

• Gene Location: Start: 105714; End: 107486 Strand: -

Full Sequence      

MARVDLKAKPYYLDDEAIKWVKDTIDSMTIEEKIGQLFVNMGSSRTEEYLTDVVTKYKFG
AVRYNPGTAKEVYDQNRILQKVSKIPMLIAANTEAGGNGACTDGTEIGLEVKVGATNDVK
YAYEMGRVSGIEAAAVGCNWSFAPIVDINRNWRNPIISSRTFGDDPDRVLEFSKAYMKGF
MESNMVCAMKHFPGDGIDERDQHLSNSVNTYSCEEWDETFGKVYKGMIDAGVHTVMAGHI
MMPAYQKFFNPSMKDEETMPATLCKELITDLLRGKLGFNGMVVTDASHMVGMTAMMKRSD
ILPNAIAAGCDMFLFFNDPDEDFEYMMNGYKNGVITEERLQDALERILGVKAYLGLHKKT
AEEITPPEEGLSVIGSQEFKDIAKEVSDKAITLVKNIGDSPLPLSPEKHKRILLVPQEKE
SAFALMAGGAGKKESYIDYLKNKLEAEGFDVTIYESAIDKIAKLPKEEVGQAMKNMYAGK
APITNITDNYDLIIQVAYVDSLCATVQRMEWKLSKGTPDMPWYVHELPTIFISLCCPFHL
ADVPQVKTYINAYDKNEHTLDALVEKLVGRSEFKGIDPVDSFCGLPDTRW

Enzyme Prediction     

No EC number prediction in MGYG000004781_00349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	81	314	3.2e-52	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.56e-66	28	415	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.32e-62	29	350	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.20e-27	120	361	97	310	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.73e-26	21	493	38	471	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA10123.1	0.0	4	590	2	589
ALC92197.1	4.07e-294	1	589	1	585
QFK71386.1	5.09e-293	1	588	1	586
QIM67292.1	2.19e-284	4	589	3	585
QQJ89971.1	3.10e-284	4	589	3	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.27e-145	6	589	6	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	1.72e-52	25	580	39	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.79e-52	25	580	13	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	9.21e-52	25	580	43	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	8.62e-44	27	578	10	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	1.87e-144	4	589	2	563	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	9.41e-52	25	580	39	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.41e-27	50	458	55	471	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7NWB7	1.08e-23	119	321	100	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q0AF74	1.05e-22	86	326	58	293	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004781_00349.