CAZyme Information: MGYG000004781_02271

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680
• CAZyme ID: MGYG000004781_02271
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		36942.61	9.3278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004781	3497015	MAG	China	Asia

• Gene Location: Start: 2420; End: 3370 Strand: -

Full Sequence      

MEEKKEQTKEYQVDLVIPVYKPTKEFQKTLKRIEAQTRKPDRIILINTEKKYFDPSCLEG
ISNVEVHHIKKEEFDHGGTRNQAAKLSSADIIIFMTQDAIPANQHMIEALLQPFEDEQVS
VVYGRQMADAKKSPIEAYTRTFNYPTISKKKTKEDLDTLGIKTFFCSNVCAAYRKKDYDQ
AGGFVTKTIFNEDMILASKFIEMGKAVYYCSDAKVWHWHDYSAMEQFHRNFDLAVSQQTY
GGLFLKVKSESEGIRLVISTLKYLLRTGKWYLVPKLIWQSGWKFLGYRFGKSYEKLPTWL
IKKCTMNPSYWEKIFQ

Enzyme Prediction     

No EC number prediction in MGYG000004781_02271.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	15	179	8.6e-20	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	3.31e-13	14	176	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.70e-10	16	126	2	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1215	BcsA	1.80e-09	13	216	56	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG0463	WcaA	3.08e-08	13	303	5	288	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06423	CESA_like	1.13e-07	15	189	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQP38206.1	2.05e-140	13	312	3	303
CBL37393.1	2.05e-140	13	312	3	303
QCP35188.1	4.64e-128	13	312	3	302
QUF79163.1	6.36e-128	13	312	7	306
SOB72012.1	2.58e-127	13	312	7	306

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	2.59e-62	13	314	3	305	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004781_02271.