CAZyme Information: MGYG000004816_01143

Basic Information

• Species: Phascolarctobacterium_A sp900757795
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900757795
• CAZyme ID: MGYG000004816_01143
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000004816_11|CGC1	36792.28	9.3766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004816	1941300	MAG	China	Asia

• Gene Location: Start: 11190; End: 12152 Strand: +

Full Sequence      

MLALLVACVGYMCACFAAKPNQAPPMQPQRAAWLVYWDWEQGLAKAQLDKEQTYIVFAAS
FDKKGKLLLPEQFNVEDLSKIPREQLFLSIVNDREGKKNQLLQKDITILKRKLSGKKRRR
KHVQQIIDLCKENGFSGVEIDYENIWQDEKLIQNFALFTAELRDKTQEAGLKLRVVLEPK
SLSYAELLPENVEYVVMFYNLYGLHSGPGPKADEKFILRTLKKIEKLRGTPNIAFANGGF
SWTSGQRAKSLTSQQAAALAQKHDVVPQRDAQSYALHFSYEEAGKQYTVWYADEETLNFW
YQTAAAYGYKRFSLWRLEGK

Enzyme Prediction     

No EC number prediction in MGYG000004816_01143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	99	319	1.5e-18	0.7094594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	7.08e-31	113	317	83	290	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	9.73e-31	53	317	27	302	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.90e-17	113	317	186	407	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	7.27e-11	35	315	4	302	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	1.77e-10	53	201	25	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ22057.1	2.06e-71	31	319	36	324
AEB99159.1	3.17e-70	1	319	5	330
AIF51322.1	1.00e-66	29	319	41	336
QJW47165.1	5.77e-66	30	319	43	337
QJW47164.1	5.77e-66	30	319	43	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	2.49e-07	123	317	100	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	5.81e-07	121	317	198	410	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	2.34e-07	123	317	192	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	4.72e-06	48	297	45	308	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	5.62e-06	121	317	197	409	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001832	0.456818	0.540624	0.000298	0.000220	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004816_01143.