CAZyme Information: MGYG000004824_01122

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000004824_01122
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000004824_10|CGC1	84449.42	5.3135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004824	2984736	MAG	China	Asia

• Gene Location: Start: 19198; End: 21468 Strand: -

Full Sequence      

MKRFYFLILFVLTGITQVLSDELPKYLQKNLSYEERVEDLLRRMTLHEKVLQLQNRSTSD
IKAIKDTYKDESYGSAHEMSLSAKDAALLFKEMQNHMIHHTRLGIPILTTVEGIHGILQN
GCTIFPQAIAQGATFNPELIQRMAEAEAEEARTIGIRQLLSPVLDIARELRWGRVEETFG
EDPYLIAQMGIHFVKGAQSKGVGCMPKHFAAHGTPTGGLNCAYVPGGERELRNLYLYPFK
RVIAEAHPTAIMSCYSAYDGIPVTGSSYFMTDILRGELGFDGFAYSDWGSVERLKTFHFS
VPTTEDAARQALMAGIDMDVYDWAYQTLEEQVKKGILDEYYVDRACRRILLAKFKAGLFD
DPYGEPDKVDKIVHNKNHVALAKQIADESIVLLKNENNLLPLDVSKYKKIALLGPNVDTG
IAGDYGWQAKDERTCVTLYEGLEKRIGNKVDIVKAEGCDWWSQNESEIADAVACAAESDL
AIVAVGTRSLWLGRDAKSAKVTSGEGFDLSSLDLPGRQLDLLKAVKATGKPMIVVLITGK
PLVMSWAAEHADAILVQFYGGEQQGLAMADVLTGEVCPSGRLNVSFPRSTGNTPCFYNYY
PTDREQIFDKAGSYDEPGGHYIFEKPYALWPFGFGLSYTDFKYEDCQLNDTVFSENGTLK
AEVTVRNVGSCDGKEVVQLYVRDMISSVAVPIQQLKAFRKVFIPAGEKVTVQLELPISEL
ALYDERLRHRVEPGTFEIRIGRSSDQAEFIRQIEVK

Enzyme Prediction     

EC	3.2.1.37	3.2.1.55	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	319	1.8e-69	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.68e-165	1	749	1	762	beta-glucosidase BglX.
COG1472	BglX	2.00e-92	44	450	1	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.79e-69	45	350	1	314	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.31e-67	3	713	6	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.42e-67	390	638	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK83130.1	0.0	20	755	24	756
ABR38447.1	0.0	20	756	24	757
QQY38586.1	0.0	20	756	24	757
BCI61926.1	0.0	1	756	1	753
QEM11461.1	0.0	19	756	24	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	2.66e-160	20	745	1	746	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.09e-159	20	745	1	746	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.01e-128	11	751	25	781	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.56e-122	98	748	65	726	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	8.53e-122	98	748	65	726	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.41e-140	78	744	43	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.96e-115	37	741	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	6.20e-114	37	744	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.38e-109	26	744	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.72e-92	103	741	122	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000205	0.999200	0.000152	0.000146	0.000137	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004824_01122.