CAZyme Information: MGYG000004871_00588

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004871_00588
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	MGYG000004871_7|CGC2	61877.84	9.8608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004871	2408616	MAG	Chile	South America

• Gene Location: Start: 64116; End: 65744 Strand: -

Full Sequence      

MNKTQRILLLSIVCIITFFVNNQVLVPDIMESRNIITAREMARGGDWIVPTMNGELRLEK
PPLPTWVTAIAEMAAPDNVALQRGGAGLAALLLAFFFYKYASRVLKIEPVVPTLLLCTCY
NVILMGRTASWDIYTHAFMMGGIYFLARALQKERRSWGDFMGFAIFTGLSIMSKGPVSLF
ALFLPFLLSYCYFYRPKMRGKWGALGVAVVVALAIGGWWYLYVHIACADAWQAVMAKESG
AWLEHNVRPWYYYWKFFLETGVWSLLLLLAMFLPLANPSRRRSRKWMFAMGWMLCSLLLL
SLMPEKKPRYLLPLLIPACYVMGCLLAWWRESFRDPARAARADKLSFRINCGLIAVAVAL
LPVLAWFFFVAKDYMPILPWTIFSLLCLVIAYYLAAAAVKLKPTGMVLATTALFLVSECM
AMPYLKNIINNPERHSIEATRDIRRLDGLQFYNIAAEPIRIEMVYAADRTIRPIDPDTLG
RALPCVLLTHEPVGKALPARLLEGVDTIVIDRYDDNRRPKGTRRYRRDMIYYVTILRSKT
EK

Enzyme Prediction     

No EC number prediction in MGYG000004871_00588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	419	7.2e-64	0.7833333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.31e-21	6	417	10	415	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.75e-04	60	177	2	118	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDV17136.1	1.35e-18	27	327	295	600
QDT27570.1	3.14e-18	27	327	295	600
QDU49608.1	1.70e-17	27	327	295	600
QOY69087.1	5.75e-17	26	376	29	373
QUW64685.1	5.75e-17	26	376	29	373

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KCC9	4.81e-16	26	361	47	380	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
A6V1N8	7.74e-15	1	365	1	360	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
O67270	2.09e-14	5	313	3	308	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4K884	1.05e-13	26	326	62	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q4KC80	3.02e-13	26	373	29	368	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.941737	0.057272	0.000697	0.000085	0.000066	0.000164

TMHMM  Annotations     

start	end
7	26
79	98
110	129
133	150
162	184
204	226
254	276
286	303
310	329
349	370
377	399
403	425