Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.H04987.1 |
Family | GT13 |
Protein Properties | Length: 143 Molecular Weight: 16307.9 Isoelectric Point: 9.6932 |
Chromosome | Chromosome/Scaffold: 8 Start: 71430033 End: 71431878 |
Description | alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT13 | 12 | 134 | 0 |
AVGSSLGQFFRQYLEPIKLNDVQVDWKSKDFSYLMEDEYIKHFAAILKNVKPIYGADAVLKASNVQGDVRVQYKDQPDFERIARQFGVFQEWKDGVPRTA YKGVVVFRCPPPRRVFLVGPKSF |
Full Sequence |
---|
Protein Sequence Length: 143 Download |
MYLLGYFNMN SAVGSSLGQF FRQYLEPIKL NDVQVDWKSK DFSYLMEDEY IKHFAAILKN 60 VKPIYGADAV LKASNVQGDV RVQYKDQPDF ERIARQFGVF QEWKDGVPRT AYKGVVVFRC 120 PPPRRVFLVG PKSFELLGIK GA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd02514 | GT13_GLCNAC-TI | 3.0e-31 | 9 | 114 | 109 | + GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13. | ||
pfam03071 | GNT-I | 2.0e-46 | 14 | 114 | 101 | + GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localised to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0000139 | Golgi membrane |
GO:0003827 | alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity |
GO:0006487 | protein N-linked glycosylation |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAB53347.1 | 0 | 14 | 138 | 318 | 442 | alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [Nicotiana tabacum] |
EMBL | CAC80699.1 | 0 | 14 | 140 | 245 | 371 | N-acetylglucosaminyltransferase I [Solanum tuberosum] |
EMBL | CAN80632.1 | 0 | 14 | 139 | 102 | 227 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002313578.1 | 0 | 14 | 142 | 313 | 441 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002328134.1 | 0 | 14 | 142 | 32 | 160 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1foa_A | 0.00000000000005 | 14 | 135 | 221 | 341 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
PDB | 1fo9_A | 0.00000000000005 | 14 | 135 | 221 | 341 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
PDB | 2apc_A | 0.00000000000005 | 14 | 135 | 215 | 335 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
PDB | 2am5_A | 0.00000000000005 | 14 | 135 | 215 | 335 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
PDB | 2am4_A | 0.00000000000005 | 14 | 135 | 215 | 335 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FY838762 | 130 | 14 | 143 | 0 |
HS064050 | 130 | 14 | 143 | 0 |
HS064026 | 130 | 14 | 143 | 0 |
JK687533 | 125 | 19 | 143 | 0 |
BP944117 | 129 | 12 | 140 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|