| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_901813g0010 |
| Family | GT13 |
| Protein Properties | Length: 134 Molecular Weight: 15641.8 Isoelectric Point: 9.46 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT13 | 4 | 127 | 0 |
| QWQGSSLGQFFRQYLESIKLNNVPVNWKSKDLSYLSEANYPKYFAKLVSSATPVYGEDVVQKAYNIDGDVRIEYRNQGHFEQIARKFGIFEEWKDGIPRT SYKGVVVFRWQTARRIFLVGPESL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 134 Download |
| MTVQWQGSSL GQFFRQYLES IKLNNVPVNW KSKDLSYLSE ANYPKYFAKL VSSATPVYGE 60 DVVQKAYNID GDVRIEYRNQ GHFEQIARKF GIFEEWKDGI PRTSYKGVVV FRWQTARRIF 120 LVGPESLKEL GIDY |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd02514 | GT13_GLCNAC-TI | 7.0e-43 | 6 | 126 | 124 | + GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13. | ||
| pfam03071 | GNT-I | 1.0e-52 | 1 | 134 | 134 | + GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localised to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAC80698.1 | 0 | 6 | 133 | 302 | 429 | N-acetylglucosaminyltransferase I [Solanum tuberosum] |
| EMBL | CAC80699.1 | 0 | 6 | 133 | 244 | 371 | N-acetylglucosaminyltransferase I [Solanum tuberosum] |
| EMBL | CAN80632.1 | 0 | 6 | 133 | 101 | 228 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI29533.1 | 0 | 6 | 133 | 312 | 439 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002328134.1 | 0 | 6 | 133 | 31 | 158 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1fo8_A | 2e-17 | 1 | 126 | 210 | 334 | A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I |
| PDB | 1foa_A | 2e-17 | 1 | 126 | 215 | 339 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
| PDB | 1fo9_A | 2e-17 | 1 | 126 | 215 | 339 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
| PDB | 2apc_A | 2e-17 | 1 | 126 | 209 | 333 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
| PDB | 2am5_A | 2e-17 | 1 | 126 | 209 | 333 | A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GE475470 | 129 | 6 | 134 | 0 |
| EX343850 | 129 | 6 | 134 | 0 |
| EX344221 | 129 | 6 | 134 | 0 |
| DV973935 | 128 | 6 | 133 | 0 |
| GW746249 | 125 | 10 | 134 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |