| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma03g28841.1 |
| Family | GH17 |
| Protein Properties | Length: 145 Molecular Weight: 16422.7 Isoelectric Point: 10.4919 |
| Chromosome | Chromosome/Scaffold: 03 Start: 36774398 End: 36775694 |
| Description | beta-1,3-glucanase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 144 | 1.20512e-43 |
| MRIYDRNQQVLQALRGSSIELLLDLPNIDLQRVASSQDNANRWVQDNVKKFGNVRFRYFSMRNEVKPWDSFARFLVLAMQNIQRPISSVGLGNQIKVSTA IETGALAESYPPSRGSFRSDYRTAYLDGVIRFLVNNNAPLLVNV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 145 Download |
| MRIYDRNQQV LQALRGSSIE LLLDLPNIDL QRVASSQDNA NRWVQDNVKK FGNVRFRYFS 60 MRNEVKPWDS FARFLVLAMQ NIQRPISSVG LGNQIKVSTA IETGALAESY PPSRGSFRSD 120 YRTAYLDGVI RFLVNNNAPL LVNV* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 8.0e-43 | 1 | 132 | 133 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB03501.1 | 0 | 1 | 144 | 64 | 208 | beta-1,3-glucanase [Glycine max] |
| GenBank | AAS09829.1 | 0 | 1 | 144 | 18 | 162 | endo-beta-1,3-glucanase [Glycine tabacina] |
| GenBank | AAS09831.1 | 0 | 1 | 144 | 11 | 155 | endo-beta-1,3-glucanase [Glycine falcata] |
| GenBank | AAS09832.1 | 0 | 1 | 144 | 23 | 167 | endo-beta-1,3-glucanase [Glycine soja] |
| GenBank | AAS09838.1 | 0 | 1 | 144 | 23 | 167 | endo-beta-1,3-glucanase [Glycine soja] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 1e-39 | 1 | 144 | 30 | 173 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 1e-38 | 1 | 144 | 31 | 177 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 1e-38 | 1 | 144 | 31 | 177 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 1e-38 | 1 | 144 | 31 | 177 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 1e-38 | 1 | 144 | 31 | 177 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FS249999 | 132 | 1 | 132 | 0 |
| BM143366 | 125 | 1 | 124 | 0 |
| EH221124 | 132 | 1 | 131 | 0 |
| FS239240 | 126 | 1 | 126 | 0 |
| FS250540 | 126 | 1 | 126 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |