Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma13g05601.1 |
Family | GT1 |
Protein Properties | Length: 150 Molecular Weight: 17264.3 Isoelectric Point: 8.362 |
Chromosome | Chromosome/Scaffold: 13 Start: 5956337 End: 5956835 |
Description | UDP-glycosyltransferase 74 F1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 5 | 130 | 2.1e-23 |
VVYVSFGSIVTFVQEQMEEVACYSREFSSYFLWVVKASEEIKLPMRKEQKRAVGCFVIHCGWNSILQTLCLGVPIIGIPCWSDQRTNAKLIADVWKIGIR TPIDEKNIVRQEALKHCIKEIMDGDK |
Full Sequence |
---|
Protein Sequence Length: 150 Download |
MVNIVVYVSF GSIVTFVQEQ MEEVACYSRE FSSYFLWVVK ASEEIKLPMR KEQKRAVGCF 60 VIHCGWNSIL QTLCLGVPII GIPCWSDQRT NAKLIADVWK IGIRTPIDEK NIVRQEALKH 120 CIKEIMDGDK EMKTNVIQWR TLAIYKSYQ* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02210 | PLN02210 | 8.0e-24 | 5 | 128 | 145 | + UDP-glucosyl transferase | ||
PLN02448 | PLN02448 | 3.0e-25 | 2 | 133 | 156 | + UDP-glycosyltransferase family protein | ||
PLN02555 | PLN02555 | 7.0e-30 | 5 | 143 | 168 | + limonoid glucosyltransferase | ||
PLN02152 | PLN02152 | 1.0e-32 | 5 | 144 | 172 | + indole-3-acetate beta-glucosyltransferase | ||
PLN02173 | PLN02173 | 2.0e-43 | 5 | 144 | 163 | + UDP-glucosyl transferase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABN08985.1 | 0 | 5 | 144 | 59 | 218 | UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula] |
GenBank | ABN08986.1 | 0 | 5 | 144 | 273 | 432 | UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula] |
GenBank | ABN08989.1 | 9.94922e-44 | 5 | 143 | 275 | 434 | UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula] |
GenBank | ACU19612.1 | 0 | 5 | 144 | 272 | 431 | unknown [Glycine max] |
DDBJ | BAB86925.1 | 0 | 5 | 144 | 93 | 252 | glucosyltransferase-7 [Vigna angularis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 3e-16 | 5 | 143 | 297 | 456 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2acw_B | 3e-16 | 5 | 137 | 278 | 444 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acw_A | 3e-16 | 5 | 137 | 278 | 444 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acv_B | 3e-16 | 5 | 137 | 278 | 444 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2acv_A | 3e-16 | 5 | 137 | 278 | 444 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
crocetin esters biosynthesis | RXN-8471 | EC-2.4.1.271 | crocetin glucosyltransferase |
crocetin esters biosynthesis | RXN-8473 | EC-2.4.1.271 | crocetin glucosyltransferase |
crocetin esters biosynthesis | RXN-8475 | EC-2.4.1.271 | crocetin glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO984858 | 163 | 5 | 149 | 0 |
EH219444 | 156 | 12 | 149 | 0 |
GR842244 | 160 | 5 | 144 | 0 |
GR842243 | 160 | 5 | 144 | 0 |
CV543630 | 158 | 5 | 144 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|