Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_199326g0010 |
Family | GH17 |
Protein Properties | Length: 79 Molecular Weight: 8593.22 Isoelectric Point: 4.3466 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH17 | 1 | 77 | 3.1e-30 |
GWPSAGADAATVENAQSYNNNLIQHILSNAGTPKRSGTSIETYIFALFNEDNKTGDETERHFGLFNPDQSPAYSVNF |
Full Sequence |
---|
Protein Sequence Length: 79 Download |
GWPSAGADAA TVENAQSYNN NLIQHILSNA GTPKRSGTSI ETYIFALFNE DNKTGDETER 60 HFGLFNPDQS PAYSVNFSP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00332 | Glyco_hydro_17 | 1.0e-33 | 1 | 77 | 77 | + Glycosyl hydrolases family 17. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAV66572.1 | 1e-31 | 1 | 79 | 265 | 343 | glucanase-like protein [Thuja occidentalis] |
GenBank | ABK23947.1 | 1.4013e-45 | 1 | 79 | 266 | 344 | unknown [Picea sitchensis] |
GenBank | ABK25991.1 | 7e-33 | 1 | 79 | 263 | 342 | unknown [Picea sitchensis] |
DDBJ | BAD93486.1 | 9e-35 | 1 | 78 | 269 | 346 | pollen allergen CJP38 [Cryptomeria japonica] |
RefSeq | XP_002459074.1 | 6e-32 | 1 | 78 | 258 | 332 | hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4gzj_A | 5e-28 | 1 | 78 | 238 | 315 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 4gzi_A | 5e-28 | 1 | 78 | 238 | 315 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
PDB | 3ur8_B | 6e-28 | 1 | 78 | 238 | 315 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
PDB | 3ur8_A | 6e-28 | 1 | 78 | 238 | 315 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
PDB | 3ur7_B | 6e-28 | 1 | 78 | 238 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO484154 | 79 | 1 | 79 | 0 |
DR540433 | 79 | 1 | 79 | 0 |
DR551649 | 79 | 1 | 79 | 0 |
ES668523 | 79 | 1 | 79 | 0 |
CO229187 | 79 | 1 | 79 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|