| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_199326g0010 |
| Family | GH17 |
| Protein Properties | Length: 79 Molecular Weight: 8593.22 Isoelectric Point: 4.3466 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 77 | 3.1e-30 |
| GWPSAGADAATVENAQSYNNNLIQHILSNAGTPKRSGTSIETYIFALFNEDNKTGDETERHFGLFNPDQSPAYSVNF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 79 Download |
| GWPSAGADAA TVENAQSYNN NLIQHILSNA GTPKRSGTSI ETYIFALFNE DNKTGDETER 60 HFGLFNPDQS PAYSVNFSP |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 1.0e-33 | 1 | 77 | 77 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAV66572.1 | 1e-31 | 1 | 79 | 265 | 343 | glucanase-like protein [Thuja occidentalis] |
| GenBank | ABK23947.1 | 1.4013e-45 | 1 | 79 | 266 | 344 | unknown [Picea sitchensis] |
| GenBank | ABK25991.1 | 7e-33 | 1 | 79 | 263 | 342 | unknown [Picea sitchensis] |
| DDBJ | BAD93486.1 | 9e-35 | 1 | 78 | 269 | 346 | pollen allergen CJP38 [Cryptomeria japonica] |
| RefSeq | XP_002459074.1 | 6e-32 | 1 | 78 | 258 | 332 | hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4gzj_A | 5e-28 | 1 | 78 | 238 | 315 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 4gzi_A | 5e-28 | 1 | 78 | 238 | 315 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
| PDB | 3ur8_B | 6e-28 | 1 | 78 | 238 | 315 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
| PDB | 3ur8_A | 6e-28 | 1 | 78 | 238 | 315 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
| PDB | 3ur7_B | 6e-28 | 1 | 78 | 238 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO484154 | 79 | 1 | 79 | 0 |
| DR540433 | 79 | 1 | 79 | 0 |
| DR551649 | 79 | 1 | 79 | 0 |
| ES668523 | 79 | 1 | 79 | 0 |
| CO229187 | 79 | 1 | 79 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |