| Basic Information | |
|---|---|
| Species | Carica papaya |
| Cazyme ID | evm.TU.contig_29840.1 |
| Family | GH17 |
| Protein Properties | Length: 100 Molecular Weight: 11042.4 Isoelectric Point: 6.2494 |
| Chromosome | Chromosome/Scaffold: 29840 Start: 2340 End: 2639 |
| Description | beta-1,3-glucanase 2 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 98 | 1.7e-37 |
| MVEAVHSALEKVGGGSLEVVVTESGWPTAGDIGASFENAQTYNNNLIQHVKQGTPKKPGKPTETYLFAMFNERGKEPEVEKNWGLFFPNKEHKYPVNF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 100 Download |
| MVEAVHSALE KVGGGSLEVV VTESGWPTAG DIGASFENAQ TYNNNLIQHV KQGTPKKPGK 60 PTETYLFAMF NERGKEPEVE KNWGLFFPNK EHKYPVNFF* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG5309 | COG5309 | 2.0e-6 | 9 | 86 | 81 | + Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-43 | 1 | 98 | 99 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAD04296.1 | 5.04467e-44 | 1 | 98 | 36 | 133 | basic extracellular beta-1,3-glucanase precursor [Vitis vinifera] |
| EMBL | CAB91554.1 | 3.00018e-42 | 1 | 98 | 247 | 344 | beta 1-3 glucanase [Vitis vinifera] |
| RefSeq | XP_002277511.1 | 1.99965e-42 | 1 | 98 | 247 | 344 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002323325.1 | 1.00053e-42 | 1 | 98 | 106 | 203 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002533898.1 | 2.99878e-43 | 1 | 98 | 159 | 256 | Glucan endo-1,3-beta-glucosidase, basic isoform precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f55_D | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3f55_C | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3f55_B | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3f55_A | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3em5_D | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GH618811 | 98 | 1 | 98 | 6e-38 |
| HS396360 | 98 | 1 | 98 | 5e-37 |
| HS052082 | 98 | 1 | 98 | 1e-36 |
| HS396420 | 97 | 2 | 98 | 4e-36 |
| CV129721 | 98 | 1 | 98 | 5e-36 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |