Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_5905665g0010 |
Family | PL1 |
Protein Properties | Length: 98 Molecular Weight: 10815.1 Isoelectric Point: 5.386 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
PL1 | 3 | 98 | 1.4e-34 |
RDSPGHYEWRSMSDGDGISIRGASNIWVDHCSLSSCTDGLIDATLGSTAITLSNNFMTHHDKVMLLGHSDDYTQDVKMQVTVAFNHFGEGLVQRMP |
Full Sequence |
---|
Protein Sequence Length: 98 Download |
MVRDSPGHYE WRSMSDGDGI SIRGASNIWV DHCSLSSCTD GLIDATLGST AITLSNNFMT 60 HHDKVMLLGH SDDYTQDVKM QVTVAFNHFG EGLVQRMP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG3866 | PelB | 1.0e-15 | 18 | 98 | 91 | + Pectate lyase [Carbohydrate transport and metabolism] | ||
smart00656 | Amb_all | 9.0e-37 | 15 | 98 | 93 | + Amb_all domain. | ||
pfam00544 | Pec_lyase_C | 3.0e-37 | 1 | 98 | 106 | + Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAM12784.1 | 0 | 1 | 98 | 185 | 282 | putative pectate-lyase [Capsicum annuum] |
GenBank | ABK25017.1 | 0 | 1 | 98 | 219 | 316 | unknown [Picea sitchensis] |
GenBank | ABO28477.1 | 0 | 1 | 98 | 189 | 286 | pectate lyase precursor [Glycine max] |
GenBank | ABO28478.1 | 0 | 1 | 98 | 8 | 105 | pectate lyase precursor [Glycine max] |
GenBank | ABQ45845.1 | 0 | 1 | 98 | 43 | 140 | pectate lyase 1 [Citrus unshiu] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1pxz_B | 9e-29 | 16 | 98 | 149 | 231 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
PDB | 1pxz_A | 9e-29 | 16 | 98 | 149 | 231 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
PDB | 1bn8_A | 0.0000000009 | 18 | 98 | 205 | 302 | A Chain A, Bacillus Subtilis Pectate Lyase |
PDB | 3zsc_A | 0.000000001 | 16 | 98 | 115 | 199 | A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima |
PDB | 2bsp_A | 0.000000003 | 18 | 98 | 205 | 302 | A Chain A, Bacillus Subtilis Pectate Lyase R279k Mutant |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO481108 | 98 | 1 | 98 | 0 |
CO481634 | 98 | 1 | 98 | 0 |
ES250755 | 98 | 1 | 98 | 0 |
CO201745 | 98 | 1 | 98 | 0 |
EX333160 | 98 | 1 | 98 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|