| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.012G013600.1 |
| Family | GH28 |
| Protein Properties | Length: 190 Molecular Weight: 20152.1 Isoelectric Point: 7.755 |
| Chromosome | Chromosome/Scaffold: 12 Start: 1324692 End: 1327038 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 13 | 177 | 2.6e-39 |
| AILNGTANVNITQVFCGPGHGIGAGSMGENTSLDKKDILVGLTVRNCTFANTSDGVRIKTWESPHEGVASGFTYEDITMDGVQHPINIDQHYCPFPLCDT RTPSHIQLKILYTITLGVTSKLRTAVSLNCSSVHPCENIVLTDINLVYKGKEGPAIALCSNIHGS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 190 Download |
| MFGPSSAPSA RKAILNGTAN VNITQVFCGP GHGIGAGSMG ENTSLDKKDI LVGLTVRNCT 60 FANTSDGVRI KTWESPHEGV ASGFTYEDIT MDGVQHPINI DQHYCPFPLC DTRTPSHIQL 120 KILYTITLGV TSKLRTAVSL NCSSVHPCEN IVLTDINLVY KGKEGPAIAL CSNIHGSLSG 180 IQKPPSCLR* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02218 | PLN02218 | 3.0e-27 | 13 | 173 | 161 | + polygalacturonase ADPG | ||
| PLN03010 | PLN03010 | 3.0e-27 | 13 | 179 | 167 | + polygalacturonase | ||
| PLN02155 | PLN02155 | 1.0e-28 | 13 | 188 | 176 | + polygalacturonase | ||
| pfam00295 | Glyco_hydro_28 | 2.0e-36 | 13 | 179 | 167 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 6.0e-44 | 13 | 187 | 176 | + polygalacturonase/glycoside hydrolase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PIR | 1.96182e-44 | 18 | 187 | 211 | 377 | UP10_LACSN Unknown protein 10 from 2D-PAGE | |
| RefSeq | NP_177961.2 | 9.80909e-45 | 13 | 189 | 230 | 404 | glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] |
| RefSeq | XP_002300425.1 | 0 | 13 | 187 | 196 | 367 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002314146.1 | 0 | 13 | 189 | 217 | 393 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002318410.1 | 0 | 1 | 189 | 1 | 189 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2iq7_G | 0.00003 | 15 | 104 | 181 | 266 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_F | 0.00003 | 15 | 104 | 181 | 266 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_E | 0.00003 | 15 | 104 | 181 | 266 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_D | 0.00003 | 15 | 104 | 181 | 266 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_C | 0.00003 | 15 | 104 | 181 | 266 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FD953219 | 180 | 13 | 190 | 0 |
| EX751911 | 180 | 13 | 190 | 0 |
| DT741125 | 175 | 13 | 187 | 1.4013e-45 |
| FD952522 | 175 | 13 | 187 | 9.80909e-45 |
| EY915412 | 175 | 13 | 187 | 1.96182e-44 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Citrus sinensis | orange1.1g047946m | ||||
| Glycine max | Glyma14g23621.1 | ||||
| Malus domestica | MDP0000284808 | ||||
| Prunus persica | ppa012438m | ppa026186m | |||
| Vitis vinifera | GSVIVT01020328001 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |