Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000143085.1 (Total 11 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_083781466.1	3997	4218	-	74	3.5	8.6696	Acr	0.147795176	764	-4.771527	Not found in Prophage	Not found in Prophage	-	-	MEKIEQAGAKGIFLPPYYPELNPIEYAWSKLKYALKKKAARTKEQLYQALSEEFTLISPQNCQAYFKHCGLCP	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 1	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_049772884.1	4273	4488	-	72	2	8.0256	Acr	0.156793068	881	-4.919352	Not found in Prophage	Not found in Prophage	-	-	MLDETRAVLNLTPAYGRAPQGQRTYGEKPTTQGKRISALSLTGALPAMCFEGTLNGAVFLYYVEHFLWPHL	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 1	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_013219115.1	4617	4952	-	112	1.5	7.2793	WP_104898562.1\|HTH_33-1-AcrIIA15\|36.2\|1.4e-13	0.13427072	451	-4.284805	Not found in Prophage	Not found in Prophage	-	-	MGLNVMPAPYSLDLRQKVIEVYANEEGSIHQLATRFKLSKNTVSGFLKRLRETGTVHPKRREGVEHLAKMDEPRAQSMAEVLQREPDLTLQEWCQRFEVRFGETISTSAMD	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 1	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_095522179.1	5011	5112	-	34	3	10.32	Acr	0.231605346	544	-4.472538	Not found in Prophage	Not found in Prophage	-	-	MFLHEQAEEFGVHTSSINRALKTLGIVKKKIAV	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 1	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_013219114.1	3462	3974	-	171	8.5	9.1419	Acr	0.117040166	1515	-5.3950233	Not found in Prophage	Not found in Prophage	-	-	MKRQEFVEKLAAEHRIFGFKNLIYIDESGFDDHCHRDMGLGIKTRLVRGKCKRRTRTHLIMAQRHGLRSGKKEWLAPILFEGSCTTALVETGIEQCLMKELYEPTIIVMDNASFHNYKRIQDIIAPAYHDLSPLPPYSPDVNPIEKTFGAMKKRRQSLSEGSTIDQLVIS	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 10	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_095522190.1	2860693	2861058	-	122	14	10.9361	AcrIIIB1-1-WP_110929174.1\|HTH_21\|30.9\|1.7e-11	0.137786226	288	-3.8388824	Not found in Prophage	Not found in Prophage	PHAGE_Bacter_Diva_NC_028788-gi\|971743567\|ref\|YP_009197973.1\|\|8.59e-16	-	MVKPGPRTTNRYSAEFKSVAVRLSQPPPGTLVHSDRGVEFLADKYKRALARTDLVQSLNRPRRMTDNAHMESWNKTMKSDRYHRQHFTTDHALRAAVRSYVEFYNRYRLHSSLGYRSPIEF	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 10	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_013219491.1	2861113	2861646	-	178	19.5	10.6701	Acr	0.090898192	697	-4.690562	Not found in Prophage	Not found in Prophage	-	-	MKRQEYLEKLRAEHRMRGFKNLIYIDETGFDAPCYRDMGWVTKGQKILGLVSGKRKRRTNLIMAQRHNASGRQKKWLAPILFEGSCTAALVETWIERCLMKKLDEPTIIVMDNASFHKHKRIQKFVAPAYHMVIPLPPYSPDFNPIEKTFGAMKKRRKSIPQNTTIDQLILSYNSMK	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 10	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_013219492.1	2861660	2861986	-	109	10.5	10.4185	AcrIIA7-0-3300012940_____Ga0164243_10002086_10\|HTH_23\|48.1\|0.002	0.113730431	962	-5.003332	Not found in Prophage	Not found in Prophage	PHAGE_Plankt_PaV_LD_NC_016564-gi\|371496264\|ref\|YP_004957412.1\|\|0.008	-	MLCFSMTYSLDLREAALSYIKNGGSKVEASRLFGFSRSTLYRWLDMEDLTPKIHGSRDRKIDKEALKKHVKDHPDMFLHERAEIFGVAVSGMHYALKRLGIVKKRARV	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 10	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_083781478.1	2862044	2862328	-	95	4.5	9.355	Acr	0.180815383	88	-2.5697699	Not found in Prophage	Not found in Prophage	-	-	MHGQSGTSYRNIGGTTYGSDGTSYRGIGNTTYGSDGSSSRRIGNSTYNSDGSSSRQIGNTLYNSDGSTVRRIGNATYGSDGTTCRKVGSSTYCN	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii
Acr-Aca 11	Low Confidence	Nitrosococcus watsonii C-113	NC_014315.1	WP_013219492.1	3153103	3153429	+	109	10.5	10.4185	AcrIIA7-0-3300012940_____Ga0164243_10002086_10\|HTH_23\|48.1\|0.002	0.113730431	962	-5.003332	Not found in Prophage	Not found in Prophage	PHAGE_Plankt_PaV_LD_NC_016564-gi\|371496264\|ref\|YP_004957412.1\|\|0.008	-	MLCFSMTYSLDLREAALSYIKNGGSKVEASRLFGFSRSTLYRWLDMEDLTPKIHGSRDRKIDKEALKKHVKDHPDMFLHERAEIFGVAVSGMHYALKRLGIVKKRARV	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae; Nitrosococcus; Nitrosococcus watsonii

Showing 1 to 10 of 29 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_000143085.1	NC_014315	NC_014315_1[1530982;1531073] (evidence-level=1), NC_014315_2[2056356;2056446] (evidence-level=1), NC_014315_3[3072312;3072820] (evidence-level=4),	3	Nb_arrays_evidence-level_1=2,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=1	CAS-TypeIE[1531190;1538566], CAS-TypeIF[3063506;3072181],	2	CAS-TypeIE (n=1), CAS-TypeIF (n=1),

Showing 1 to 1 of 1 entries