Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000328565.1 (Total 6 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015304597.1	592844	593107	+	88	4.5	10.3019	AcrIIA15-0-WP_066196495.1\|HTH_17\|48.5\|0.0073	0.131224436	665	-4.353703	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_GIL16c_NC_006945-gi\|62327520\|ref\|YP_224099.1\|\|2.78e-07	-	MTSMNGPSARDSASGKSARDAGPTDGQPPRAQFLTVAEVASLMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLESSYFDAG	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 1	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_003402602.1	593221	593322	+	34	18.5	13.4138	Acr	0.151966971	684	-4.381117	Not found in Prophage	Not found in Prophage	-	-	MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 2	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015304612.1	604973	605569	+	199	-1	6.1211	WP_034232707.1\|HTH_Tnp_1_2-2-AcrVA5\|30.2\|0.00011	0.095099702	4829	-5.7387743	Not found in Prophage	Not found in Prophage	-	-	MPGADPTLEAILDAAVVEFERHGFRKVALDDVARRARISRTTIYRRFANKDELVAAVIERENVRLFADIAAELKQAGPQSNYYVEAFTLSILKFRRHRVLDRMMTDEPGLVLEMAGQHYGAAIERMAEALRVIFPTGFAERIGEQAVLELADTILRYAAMVLLLPSAQPLETADDVRAFATQHFLPSLPVALRAVPAG	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 2	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015304613.1	605615	605971	+	119	-12.5	4.2099	Acr	0.144660779	88	-2.720443	Not found in Prophage	Not found in Prophage	-	-	MGTEQQQRTGESEQQQQSGAPDVREQRRQAESTENSEEPKMTEKPEVTDEHKEEAKKIAKAYNDDLQTTTLPGSGGTVSGTAVTDWVDDEDKGKVETTAEEGNVEYRKTEEFRKLQES	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 3	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_083906385.1	1267560	1267874	+	105	11.5	10.948	Acr	0.163133778	292	-3.663207	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Pumpkin_NC_042027-gi\|100055\|ref\|YP_009613677.1\|\|0.005	-	MRTLRGRIGAYESWARTEDRAARTWPARKAALDRFEREVDPDGVLTPDERAKRAEWARKAHMQRLALKSAAARLRRKLICETCGQPKEPSAPLCPKCLNKIREP	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 3	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015305256.1	1267892	1268263	+	124	8.5	10.4974	Acr	0.547557748	1347	-4.892962	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Dotproduct_NC_042336-gi\|100047\|ref\|YP_009638407.1\|\|1.94e-05	-	MTIAQVAQHFGVDRTEVYYKMLPELEIRRIGVRGGAAPWGRLIRVERRSVLEICGPSTVPDEEVPRWVTLKQAATYYQVSLHLIRQMIAHEQLDARRIGSGRAIRIDRDSLLKLGCVPIRRPS	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 3	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015305257.1	1268260	1268475	+	72	8	11.7505	AcrIIA1-0-WP_005552263.1\|HTH_17\|37.5\|1.8e-05	0.181748613	198	-3.311735	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_GUmbie_NC_023746-gi\|609252700\|ref\|YP_009018916.1\|\|7.98e-15	-	MTRRRYITIAETAEYLQVSDRTVRRLIADGDLTGYRMGKSRRTIRVDLNEVDEQLMRPLNAPPRVRKRRTS	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 4	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015306149.1	2184249	2184743	+	165	-8	4.5019	Acr	0.122984396	677	-4.36921	Not found in Prophage	Not found in Prophage	-	-	MSMDRIEKEVVLRAPLARVWQAISNADEFGRWFGVRFDGPFVEGASLTGVITPTTVDDEVARMQEPHAGKSDTWQIVAIEPQRRLAFRWHPYGVETGVDYSQEPTTLVEFTLTETDEGVLLRIVESGFDKIPEERRASAFEANSQGWAKQTELVSKYLALSEKV	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 4	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015306150.1	2184740	2185072	+	111	2.5	8.5343	WP_034246637.1\|HTH_5\|AcrIIA15\|32.6\|3.4e-11	0.133961493	626	-4.3146715	Not found in Prophage	Not found in Prophage	-	-	MSKPAAVVAKAPLFDALGDPNRLRIVTRLCDGGPCSTSQVTQVVSVSRQAATKHLLLLEAVGLVSSERNGRERIWRIEPKPLSDASDFLTALSKRWDNAIDRLRAYVEDE	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623
Acr-Aca 5	Low Confidence	Mycobacterium sp. JS623	NC_019966.1	WP_015306592.1	2622047	2622448	-	134	7	9.9713	Acr	0.389244285	600	-4.286203	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Astraea_NC_021349-gi\|509142848\|ref\|YP_008061709.1\|\|0.004	-	MARPSTIIKRTCFVEADFHVGDNGSVKLVDPPNRRLTPGNVCGNPTVSFAGRTYFVADLVARAHLASKYGMILFRDGDPENCKPGNIVVIEDPYADRFAALMRRKREGVPLRGDGDRLWWREDLRTQQAKGRA	No	No	Bacteria; Actinobacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium sp. JS623

Showing 1 to 10 of 14 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_000328565.1	NC_019958	NC_019958_1[94617;95131] (evidence-level=4),	1	Nb_arrays_evidence-level_1=0,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=1	CAS-TypeIE[95110;102515],	1	CAS-TypeIE (n=1),

Showing 1 to 1 of 1 entries