Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000837485.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Methanobacterium phage psiM2	NC_001902.1	NP_046962.1	4127	4399	+	91	7	10.1784	Acr	0.284183648	11	-2.8071737	Not found in Prophage	Not found in Prophage	PHAGE_Methan_psiM2_NC_001902-gi\|9630532\|ref\|NP_046962.1\|\|5.00e-60	-	MYRGHRRIHSPPRRNNMTKEGHGCIQKERITSLEERLKNIEYDIIDIKETNKMLIDLQAEIATLKAYHKITMILLTALIIPIIITLIRTI	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Psimunavirus; Psimunavirus psiM2
Acr-Aca 1	Low Confidence	Methanobacterium phage psiM2	NC_001902.1	NP_046963.1	4440	4961	+	174	-11.5	4.4986	AcrIIA7-1-WP_000182202.1\|HTH_23\|62.5\|3.2e-05	0.429519255	5	-1.7796922	Not found in Prophage	Not found in Prophage	PHAGE_Methan_psiM2_NC_001902-gi\|9630533\|ref\|NP_046963.1\|\|1.31e-122	-	MKETPTQRKAFEYYYSLGDKRNLKKVAEKFGYSYDTIRGWSSKLRWRERIYQYEKKQLQEIRRAREELSEESKEYYADLWSKYLKACSLTLEGYIESIENGGEGLTLQTSKDLHNLGLAIALGLGDPTEIHEHRESGGELEDLLEDLVSATKNLKDEGMDEGLDDEEAEGEGG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Psimunavirus; Psimunavirus psiM2

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder