Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000893175.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Vibrio phage ICP1	NC_015157.1	YP_004251049.1	57816	57980	+	55	3	9.213	Acr	0.464117464	124	-3.1833608	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_ICP1_NC_015157-gi\|325171074\|ref\|YP_004251049.1\|\|8.20e-32	-	MEKKSLEQATKECILSLETLVLPKFIRAAEALRKAEDNYREACEKLKAAGLNKK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; UNKNOWN_genus; Vibrio phage ICP1
Acr-Aca 1	Low Confidence	Vibrio phage ICP1	NC_015157.1	YP_004251050.1	58015	58203	+	63	-1	5.0957	Acr	0.597230955	39	-1.3610456	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_ICP1_NC_015157-gi\|325171075\|ref\|YP_004251050.1\|\|2.32e-38	-	MKDFEKEYFNLLDQIDKLYEEKSVLEDQLSITRKALLSLVNKRRTGRTIGLEIKVEEFLSLC	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; UNKNOWN_genus; Vibrio phage ICP1
Acr-Aca 1	Low Confidence	Vibrio phage ICP1	NC_015157.1	YP_004251051.1	58286	58606	+	107	-1.5	5.6277	Acr	0.4556745	31	-1.0255731	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_ICP1_NC_015157-gi\|325171076\|ref\|YP_004251051.1\|\|1.97e-75	-	MSWVKVEDFVDQVKNMEDRIISVSIDTRDIACFVTDANDVGSVDFRYHTNDILEVMYKTRNYEWCWVNNMSFKYVKLLMNTQTKMCCLMDRYGEVRTLDDLKHQHK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; UNKNOWN_genus; Vibrio phage ICP1
Acr-Aca 1	Low Confidence	Vibrio phage ICP1	NC_015157.1	YP_004251052.1	58618	58974	+	119	-2	5.6121	REF:Bacilli_gi_416847937_39\|HTH_3\|AcrIIA14\|33.3\|0.0058	0.616244317	79	-2.2252724	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_ICP1_NC_015157-gi\|325171077\|ref\|YP_004251052.1\|\|1.80e-86	-	MHKEIIMCAANRYWVKKPDGEEVNIVIADSGHFMPNMQAIIKLLKDLGCELTPDKSDGDRGQGFIGAASKYYSRSEAYKIVKESGQPFNDEYTLPHDKLDSSCIRHFPEDCDLKDYMK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; UNKNOWN_genus; Vibrio phage ICP1

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder