Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000902275.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Brucella phage Pr	NC_019447.1	YP_007002071.1	1759	1851	+	31	1	7.984	Acr	0.418476264	6	-2.2601225	Not found in Prophage	Not found in Prophage	PHAGE_Brucel_Pr_NC_019447-gi\|418487840\|ref\|YP_007002071.1\|\|2.02e-15	-	MSKKGKKALQQIADQSVYDFQASQSMWFCE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Perisivirus; Brucella virus Pr
Acr-Aca 1	Low Confidence	Brucella phage Pr	NC_019447.1	YP_007002072.1	1944	2342	+	133	-2	5.9214	AcrIIA7-2-WP_046340465.1\|HTH_7\|44.6\|5.2e-12	0.111502037	11	-2.8660731	Not found in Prophage	Not found in Prophage	PHAGE_Brucel_Pr_NC_019447-gi\|418487841\|ref\|YP_007002072.1\|\|2.64e-97	-	MAGGRPTLYRPEYCETVIELGKQGDSLAQMAAHFDVSRQTIENWASDHPEFLAALSRAKVHCQAWWEKAGREGMFLGGGGFNAAVWKKSMEARFREDYTERQEVHQTGTMEHKHSIGEMTDEDLAKVIAGEK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Perisivirus; Brucella virus Pr

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder