Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000915635.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Vibrio phage PVA1	NC_023605.1	YP_009009739.1	37580	38023	+	148	-7.5	4.3849	Acr	0.152268897	1	-2.6291218	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_PVA1_NC_023605-gi\|589893595\|ref\|YP_009009739.1\|\|1.48e-108	-	MREIKFRAWLDYGDGSGEMLPNIQNHINGKWAFGHIANGSVDGVSQPMQYTGLKDKNGVEIYEGDICEVMYYTPFGDKTDNYYGKWIVTEWMGQFVMVSGKERVSFTDFADVVSSEYIPNLGTVCELSVKVNANVIGNIHQNPELLD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Vibrio phage PVA1
Acr-Aca 1	Low Confidence	Vibrio phage PVA1	NC_023605.1	YP_009009740.1	38079	38594	+	172	-0.5	6.2452	AcrIIA15-2-WP_078101762.1\|HTH_26\|AcrIIA14\|41.7\|0.0026	0.122371724	4	-3.101077	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_PVA1_NC_023605-gi\|589893596\|ref\|YP_009009740.1\|\|5.35e-127	-	MFYKSFERVIGHEGGYTDDPNDRGNWTSGKVGEGELKGTKFGISAMSYPHLDIKNLTLDEAQAIYFNDFWVKDGIDQLPKAMQYQMFDASINHGFRNATKMLQRAVDVADDGIIGKNTMKAVGQYDQLNLVLLFNNERLKFYTDIRTWSQYGKGWARRVAGNLKLGSEDAE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Vibrio phage PVA1

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder