Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001501475.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Acidianus bottle-shaped virus 3	NC_028787.1	YP_009197918.1	17202	17450	+	83	-3	4.6982	Acr	0.354108686	31	-3.7244692	Not found in Prophage	Not found in Prophage	PHAGE_Acidia_3_NC_028787-gi\|971743501\|ref\|YP_009197918.1\|\|5.95e-56	-	MKLEEFKQNYPCAYPLFPILQDIKDHVPPERHKDFENAIDQIAEFLSNVENCKTASAILSLGFIFGIPLFLGIPYLEPIFNR	No	No	Viruses; UNKNOWN_phylum; UNKNOWN_class; UNKNOWN_order; Ampullaviridae; Ampullavirus; Acidianus bottle-shaped virus 3
Acr-Aca 1	Low Confidence	Acidianus bottle-shaped virus 3	NC_028787.1	YP_009197919.1	17462	17932	+	157	4.5	8.4363	Acr	0.547409267	24	-3.612166	Not found in Prophage	Not found in Prophage	PHAGE_Acidia_3_NC_028787-gi\|971743502\|ref\|YP_009197919.1\|\|1.02e-110	-	MMKLTELEEKYPCSEKLVTALQKALIHASPEEKEIVDRFVNVLSDYLSKVPYRKEVVQAIYSALTHGVTVKSITHSLEKTLRSMKRKEEITPKPVKEEVTPKKIESINDLAKVLYEKCNEKTIESVLHTLYDFIPPNKQKMALHEAVLVMRSDNYV	No	No	Viruses; UNKNOWN_phylum; UNKNOWN_class; UNKNOWN_order; Ampullaviridae; Ampullavirus; Acidianus bottle-shaped virus 3
Acr-Aca 1	Low Confidence	Acidianus bottle-shaped virus 3	NC_028787.1	YP_009197920.1	17925	18329	+	135	6.5	9.8465	WP_090016277.1\|HTH_3\|AcrIIA1\|44.0\|0.00027	0.635061685	5	-1.3551208	Not found in Prophage	Not found in Prophage	PHAGE_Acidia_3_NC_028787-gi\|971743503\|ref\|YP_009197920.1\|\|1.67e-89	-	MFERIIKKFPFTKPLIKKLSEIYETATPKERKVINNFLEVFYNALIVVPKKEKFYKKILSDLKKGKSLKEIAEEIKRELKAEETSDVDEIVDKLIDYCDRKMTKRVIETLLSLIPDDKQEKILSKIKEMIKNEH	No	No	Viruses; UNKNOWN_phylum; UNKNOWN_class; UNKNOWN_order; Ampullaviridae; Ampullavirus; Acidianus bottle-shaped virus 3

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder