Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001636015.1 (Total 4 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_084260571.1	481644	482096	+	151	-6.5	4.509	WP_087627991.1\|HTH_XRE\|AcrIIA14\|48.6\|0.0044	0.105333852	781	-4.72842	Not found in Prophage	Not found in Prophage	PHAGE_Gordon_Bowser_NC_030930-gi\|100051\|ref\|YP_009275618.1\|\|3.65e-06	-	MSPCGQRLLQPISVRPSLVPGEYFIVAGERRYRAFQSLGEQFTDCIIKVNDAENATLALTENLSREDLIDYEVAKAILVVESKWDNKTMLAEYLGISRSILYRYLSYRKLPNSVLEMLDEDPTLLSAKTSEEVIKVAKDHGLQDDEFATS	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 1	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063513607.1	482102	482392	+	97	3.5	9.9537	Acr	0.546447667	258	-3.594779	Not found in Prophage	Not found in Prophage	-	-	MLQKAQGEQIKQSAIADLFKEKLIDPKNNKKDPSSKPEVLKSLKIGNKIIGSIKRKGDKVVVDIPHRLWVDNFEKFLLERFDVLQEENLEPLGSDK	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 2	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063514382.1	1554498	1554743	+	82	3.5	9.2749	AcrIIA7-0-3300012940_____Ga0164243_10002086_10\|HTH_23\|43.3\|0.00044	0.145620671	831	-4.794204	Not found in Prophage	Not found in Prophage	PHAGE_Burkho_KL3_NC_015266-gi\|327198097\|ref\|YP_004306464.1\|\|1.31e-07	-	MTHSNDTFPAQGISRIKSVCMMTGLSKSTIYAWVKAGKFPAPIKLSPTMTVWRNSDILDWINRLETADDCPAISQTTSTKQ	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 2	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063514383.1	1554770	1555132	+	121	14.5	10.8726	Acr	0.537829775	175	-3.2171047	Not found in Prophage	Not found in Prophage	-	-	MLPISHNQKSHQAMQVLQAMLDGVEVHIKYAINTMNIASLSARIAELKKMGFVIDWRWQNSPNSRYKVYFIKDKTTAKQRYQEILDGTASIYQVVAQARTAKPKTTTKSKRQNNGKPQGK	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 2	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063514384.1	1555136	1555348	+	71	8.5	10.2666	Acr	0.307872741	210	-3.398542	Not found in Prophage	Not found in Prophage	-	-	MQQLNISDKAKKYQATMWQVTPYSRSGKRLSQDKYLDKLMKRAIKAELTPIGALIYCREMCIKHGYPTAF	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 2	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063514385.1	1555390	1555734	+	115	-4	5.0971	Acr	0.512815438	97	-2.68561	Not found in Prophage	Not found in Prophage	-	-	MTDKHPPAQSPAISQSELDELYSELIYTYADLKNTAHNMHSILYSKCSFRRLSMEYQTLIGRLNRIIHDKLAPNIKNLSKHSDNNPLAGIPDYDKLSHASDDGDDLPADDDYPS	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 3	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063514714.1	2021346	2021564	+	73	8	9.978	Acr	0.157165501	285	-3.692472	Not found in Prophage	Not found in Prophage	PROPHAGE_Escher_MG1655-gi\|16131429\|ref\|NP_418015.1\|\|2.26e-07	-	MIDEQLMAYLVMAPATFNYCLKQLKQVDNQQQIKDKIKNTYHSYQSRYSYRRITFALKQMCFAINHKKYISS	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 3	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_084260697.1	2021702	2021923	+	74	6	10.0292	AcrIIIB1-1-WP_110929174.1\|HTH_21\|36.2\|0.00013	0.154840275	224	-3.454312	Not found in Prophage	Not found in Prophage	PROPHAGE_Escher_MG1655-gi\|16131429\|ref\|NP_418015.1\|\|9.25e-07	-	MTKFKLVDKQGNTKKLYLSPINHLFKEDIISYQMYISPNYDLVSKILDQAPKRRQAGGNGSNHHQMFMHSDQG	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 4	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_084260698.1	2025037	2025174	-	46	3	10.469	Acr	0.314822743	202	-3.35243	Not found in Prophage	Not found in Prophage	-	-	MTAKQVSNELSISDSTARKLLNELENMGLATTVRNGRGKGYLLVK	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis
Acr-Aca 4	Low Confidence	Moraxella ovis	NZ_CP011158.1	WP_063515047.1	2025217	2025495	-	93	4	9.8505	WP_143374515.1\|HTH_3\|AcrIIA15\|30.0\|0.0053	0.1825305	892	-4.876344	Not found in Prophage	Not found in Prophage	-	-	MLHLYDDIDARLALAAYLKQKRKDAKLSRRVLAEKSLIPEPTIRRFENTGHISLKNFLLLWMILDDIARFMELTKPEAIKPKTIAEVLAYDQ	No	No	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Moraxella; Moraxella ovis

Showing 1 to 10 of 10 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_001636015.1	NZ_CP011158	NZ_CP011158_1[53239;53591] (evidence-level=4), NZ_CP011158_2[903972;905051] (evidence-level=4), NZ_CP011158_3[1416251;1416371] (evidence-level=1),	3	Nb_arrays_evidence-level_1=1,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=2	CAS-TypeU[48272;53057], CAS-TypeIC[895784;903773],	2	CAS-TypeIC (n=1), CAS-TypeU (n=1),

Showing 1 to 1 of 1 entries