Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001688965.2 (Total 18 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065530169.1	141541	141957	+	139	6	9.6909	Acr	0.266696393	1382	-3.858737	Not found in Prophage	Not found in Prophage	-	-	MKEQNIIRMKCITILLFIILSVVLIVVGFSQEYHSSSLFSGGVGGLIVSLYMLKAIWSARASQRKREQLIIDETDERNLLIQKNSRAQAFNVSLIATLAASVLASLYHEEAINSCFNILLGIQLFAYLLIWMYYKRRL	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 1	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_002606417.1	141335	141544	+	70	3	8.0989	AcrIIA1-1-WP_074911965.1\|HTH_3\|50.0\|4e-14	0.149285706	153	-1.4543746	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_1_NC_009737-gi\|158348425\|ref\|YP_001522916.1\|\|8.06e-10	-	MRNRIRKLRQELQMTQEELAQRCRVSRQTIISLEKGKYDPSIHLAHRIATIFQHHIEDVFLFTEGADES	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 10	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065531158.1	2139553	2139780	-	76	-4	4.6361	Acr	0.862654164	32	-0.33446378	Not found in Prophage	Not found in Prophage	-	-	MPTLHLKENAIKRAWSAKILELVMDYNMYSHEKLEWSDFANYLEGKSIKQYEQCYKDLQNKFNEMLLEEIEEPML	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 10	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065531157.1	2139008	2139556	-	183	7.5	9.7204	WP_031874280.1\|HTH_3-0-AcrIIA14\|37.0\|1.1e-05	0.805743443	1704	-4.153228	Not found in Prophage	Not found in Prophage	-	-	MKNKILLTFDMSSIIKQKRLDKKLKQIEVASHLHIDINLYRRIEQFKIRKIDAILLKRILEYFEIPLIDFISAPTITVSSRLNETVMNDLEKIKAREHLDNTSEAIRYCVEQYLYFDKLADSKKEIIKLIEDTLYITFIKQIRSDQKRIDNLLNILKLNGLSDDEISNLENQGYKKYRSKTI	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 10	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065531156.1	2138525	2138998	-	158	6	8.8569	Acr	0.641872405	1111	-3.5802293	Not found in Prophage	Not found in Prophage	-	-	MKIIVFGNQNFMENLQKEFSELDTHLYFISHYHDKADINLIALRITNLTHLLIDGDMYNDVDLYYAIKTIKLLNPNVIIICVMNKERKLICHYLTVDELAYIVGTGIEIEHLFQDDFLAFNKSFILSIKNEKKIRKKFYKTGYDTATRKQKRGLKNG	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 11	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065531414.1	2808211	2808435	-	75	0	6.3187	Acr	0.66612806	289	-2.06648	Not found in Prophage	Not found in Prophage	-	-	MVYLVISIIALMISVICYIRVRALDNEFESLERRTYGNIKFNSFYLQPTREQLEKAERYEKILKEYKTTFEDKE	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 11	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065532473.1	2808489	2808722	-	78	1.5	7.9803	WP_125576422.1\|HTH_11-0-AcrIIA14\|38.0\|2.2e-09	0.207216437	510	-2.5997217	Not found in Prophage	Not found in Prophage	PHAGE_Clostr_phi3626_NC_003524-gi\|20065990\|ref\|NP_612856.1\|\|6.35e-17	-	MAIYESPDYVTVDEVVKRLGVKESTAYAILQEMNAELKERGFVTRAGRVPRAYFDEKCYFKPKKMSHPTTNDDATKL	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 11	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065531542.1	2808814	2809035	-	74	-10	3.9724	Acr	0.260841641	1	1.8290296	Not found in Prophage	Not found in Prophage	-	-	MIYLKKNIGNEAEIKVNICDDEFYCTCPDCGREVQLDSETLKEIICDDEYDFASTSVYCEDCSKHHIGSVGSD	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 12	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_002610466.1	3110462	3110800	-	113	2	7.9968	AcrIIA15-Aca\|WP_096540346.1\|39.1\|5.6e-13	0.156740371	171	-1.5741906	Not found in Prophage	Not found in Prophage	-	-	MSKSNTMESAQLTDAMYYILLSLMIERHGYAIMKYIEELSNQSITMGPGTLYTLLKKLCRAEWILQTSVTADRTKKYQITDTGRQVLLHEVARRKRMVEDGLRILEENGYEG	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46
Acr-Aca 12	Low Confidence	Erysipelotrichaceae bacterium I46	NZ_CP015404.2	WP_065531682.1	3110949	3111200	-	84	2	8.0929	Acr	0.313273239	2816	-4.97564	Not found in Prophage	Not found in Prophage	-	-	MGEYAIKYLCALYINVYVCVQLFFCAIKRKIPVFYMLFQEYSGISNRIPYEISVQERRDEEMKLVFVVLLCLVAVFLQPLKGM	No	No	Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales; Erysipelotrichaceae; UNKNOWN_genus; Erysipelotrichaceae bacterium I46

Showing 1 to 10 of 40 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_001688965.2	NZ_CP015404	NZ_CP015404_1[8893;9127] (evidence-level=1), NZ_CP015404_2[649125;649237] (evidence-level=1), NZ_CP015404_3[1540383;1540554] (evidence-level=1), NZ_CP015404_4[1566773;1566888] (evidence-level=1), NZ_CP015404_5[1774628;1775001] (evidence-level=4), NZ_CP015404_6[4436186;4436285] (evidence-level=1),	6	Nb_arrays_evidence-level_1=5,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=1	CAS-TypeIC[503;4463394],	1	CAS-TypeIC (n=1),

Showing 1 to 1 of 1 entries