CAZyme Information

Basic Information help

• Species: Borrelia burgdorferi B31
• CAZyme ID: NP_212393.2
• CAZy Family: GH23;
• CAZyme Description: transglycosylase SLT domain-containing protein

CAZyme Property

Protein Length	Molecular Weight	Isoelectric Point
717	83866.1	9.2897

Genome Property

Genome Assembly ID	Genome Type	GenBank ID	RefSeq ID	Length	Total # of Proteins
GCF_000008685.2	Chromosome	AE000783.1	NC_001318.1	910724	1390

• Gene Location: Start: 270488; End: 272641 Strand: -
• View CDS: CDS sequence
• UniProt ID: O51274;
• InterPro Annotation: O51274;

Genomic Context   If it does not show, please wait or refresh. help

Also see NCBI Genome Browser

Full Sequence      Download help

MFNRSSCVLQNFLFLFLFLSLVSCFAKKEISGNNFIKAHSKEFDLNNLNWLWNFDYTKKN
FDKHFNIDPSSYIYVAYLFKKIGFEEKFVEYMKKAIANGDSIASQFAGIKLIEYFNSAKE
YFASELIGEKLYKKYENNKFIILGYFKSLYWQKKNDKALSLLNKLDKMKFSDYQENENIL
LKAVLYLNLSNVSESKIYFNELFENLPANYLHVRAYDYFIIENKSRYFGANFLNLVRFKY
EVANGNFNGAINILNKNGLNDYYDNNIVLSDVYKAFISSGKVSNALTFFSKIKSKYKNYY
LGILNLREKNNLGLLLLKEYLEGLDLNNEINRLDLLNTAFSNLIFTKSARDYFAESLPKF
YTEGDKKNSTFIKILEEYILESIQLEDYGNLYKLYSNAQKVISNSVLSKLAFINARLIYH
KLIKPNVSGEYKSLLHSAVNYDKWSYSSFMSRYLLDQNIDEFFTGGSDIKYEQSDYEIFL
EGFLKFNLCNYVRGFISEDFRNGYKFSLDFYRKVYDELLKSENYYDATLVINYLVNQDES
ALMENDYKRLYPYLYGSLIEYWAKRRGLEASVVFSLIKAESSFEKNAVSKPGAVGLMQVM
PSTANDISKELKYFNYDLKIPKDNIIIGTYYLKKRISTTGSLYKALASYNGGIGNVRKWE
KSYGHLSKELFIEAIPFSQTRNYIKKILVYSVFYDALYEKKGIDSVIVKIMGEFPKN

Enzyme Prediction      help

metacyc	EC
RXN0-5190;

CAZyme Signature Domains help

Family	Start	End	Evalue
GH23	570	690	1.3e-23

CDD Domains      download full data without filtering help

Cdd ID	Domain	E-Value	Start	End	Domain Description
pfam01464	SLT	2.31e-34	559	671	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.62e-30	551	701	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT_GEWL	4.30e-24	571	690	Lytic Transglycosylase (LT) and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits      download full data without filtering help

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIU79502.1| GH23	0.0e+00	1	717	1	717
AAC66641.2| GH23	0.0e+00	1	717	1	717
ADQ30537.1| GH23	0.0e+00	1	717	1	717
AGS66278.1| GH23	0.0e+00	1	717	16	732
ADQ29271.1| GH23	0.0e+00	1	717	1	717

PDB Hits      download full data without filtering help

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YP4_A	2.1e-17	535	698	436	599	Chain A, Snm-deletion Mutant (lytic Transglycosylase)
5MPQ_A	2.1e-17	535	698	396	559	Chain A, Bulgecin A: The Key To A Broad-spectrum Inhibitor That Targets Lytic Transglycosylases
4YIM_B	2.1e-17	535	698	406	569	Chain B, Structural Characterization Of The Lytic Transglycosylase Dependent Mechanism Of Cytotoxic Peptidoglycan Fragment Release.
1SLY_A	7.8e-17	551	694	449	598	Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A
1QSA_A	3.0e-16	551	694	449	598	Chain A, Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution

Swiss-Prot Hits      download full data without filtering help

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P39434|SLT_SALTY	5.2e-16	512	694	428	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=slt PE=3 SV=2
sp|P0AGC4|SLT_ECO57	2.6e-15	551	694	476	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 GN=slt PE=3 SV=1
sp|P0AGC3|SLT_ECOLI	2.6e-15	551	694	476	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) GN=slt PE=1 SV=1
sp|B0BSH0|MLTC_ACTPJ	4.7e-09	555	687	197	354	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mltC PE=3 SV=1
sp|B3GYW8|MLTC_ACTP7	4.7e-09	555	687	197	354	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=mltC PE=3 SV=1

SignalP Annotations help

Gram-positive-SP	Gram-negative-SP
No signal petitide.	No signal petitide.

TMHMM  Annotations      download eps picure     download full data without filtering help

start	end
7	26

PSSpred  Annotations      download dat.ss data help

color explanation:  coil(C), helix(H), beta(E)

LipoP Annotations      download full data without filtering help

class	score	margin	cleavage
SpII	5.89085	4.32419	23-24