| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_142_00002.1 |
| Family | GH1 |
| Protein Properties | Length: 139 Molecular Weight: 16030.3 Isoelectric Point: 5.2375 |
| Chromosome | Chromosome/Scaffold: 142 Start: 20228 End: 21333 |
| Description | beta glucosidase 11 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 3 | 128 | 0 |
| PDKTNGDIACDGYHKYKEDMKIMKDIGLEAYRFSISWSRLLPYGRGIVNPKGVRYYNDLIDELVKNGIEPHVTIYRLDLPQILEEEYEGWLSPKIIGDFT AYAEVCFREFGDRVSHWTTLNELPTM | |||
| Full Sequence |
|---|
| Protein Sequence Length: 139 Download |
| YVPDKTNGDI ACDGYHKYKE DMKIMKDIGL EAYRFSISWS RLLPYGRGIV NPKGVRYYND 60 LIDELVKNGI EPHVTIYRLD LPQILEEEYE GWLSPKIIGD FTAYAEVCFR EFGDRVSHWT 120 TLNELPTMIP KVSQAVHL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 2.0e-56 | 1 | 124 | 124 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 4.0e-58 | 2 | 124 | 123 | + Glycosyl hydrolase family 1. | ||
| PLN02849 | PLN02849 | 9.0e-60 | 4 | 124 | 121 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 5.0e-63 | 4 | 124 | 121 | + beta-glucosidase | ||
| PLN02998 | PLN02998 | 3.0e-63 | 8 | 125 | 118 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACF87535.1 | 0 | 2 | 125 | 68 | 191 | unknown [Zea mays] |
| GenBank | EEC79079.1 | 0 | 2 | 124 | 88 | 210 | hypothetical protein OsI_19671 [Oryza sativa Indica Group] |
| RefSeq | NP_001055331.1 | 0 | 2 | 124 | 85 | 207 | Os05g0366600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001136681.1 | 0 | 2 | 125 | 68 | 191 | hypothetical protein LOC100216811 [Zea mays] |
| RefSeq | XP_002439662.1 | 0 | 3 | 133 | 71 | 200 | hypothetical protein SORBIDRAFT_09g018160 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 0 | 2 | 124 | 74 | 198 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 3ptq_A | 0 | 2 | 124 | 74 | 198 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 3ptm_B | 0 | 2 | 124 | 74 | 198 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 3ptm_A | 0 | 2 | 124 | 74 | 198 | A Chain A, Structural Insights Into Substrate Specificity And The Anti Beta-Elimination Mechanism Of Pectate Lyase |
| PDB | 3ptk_B | 0 | 2 | 124 | 74 | 198 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DT728125 | 128 | 1 | 128 | 0 |
| DT741932 | 129 | 1 | 129 | 0 |
| DR933090 | 129 | 1 | 129 | 0 |
| DR935172 | 129 | 1 | 129 | 0 |
| DR926347 | 128 | 2 | 129 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Aquilegia coerulea | Aquca_058_00197.1 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |