| Basic Information | |
|---|---|
| Species | Ricinus communis |
| Cazyme ID | 30333.m000034 |
| Family | GH23 |
| Protein Properties | Length: 133 Molecular Weight: 15159.6 Isoelectric Point: 9.8916 |
| Chromosome | Chromosome/Scaffold: 30333 Start: 43 End: 444 |
| Description | |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH23 | 7 | 116 | 6.2e-35 |
| PKLVLAIIAVESNFQTKAQSPKAAMGLMQLIPETAERFNIKNAFDAAQNIKGGIRYLRWLLSYYHGDVALVAAAYNAGEKAVDRYKGVPPYPETKNYVKR VMELYQRKFH | |||
| Full Sequence |
|---|
| Protein Sequence Length: 133 Download |
| MWYSIDPKLV LAIIAVESNF QTKAQSPKAA MGLMQLIPET AERFNIKNAF DAAQNIKGGI 60 RYLRWLLSYY HGDVALVAAA YNAGEKAVDR YKGVPPYPET KNYVKRVMEL YQRKFHPYDE 120 KFTLPSPIIT RAG |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG4623 | COG4623 | 1.0e-12 | 5 | 84 | 86 | + Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] | ||
| PRK11619 | PRK11619 | 2.0e-14 | 4 | 115 | 137 | + lytic murein transglycosylase; Provisional | ||
| COG0741 | MltE | 2.0e-21 | 3 | 121 | 141 | + Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell envelope biogenesis, outer membrane] | ||
| pfam01464 | SLT | 6.0e-25 | 3 | 93 | 97 | + Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems. | ||
| cd00254 | LT_GEWL | 1.0e-32 | 7 | 112 | 113 | + Lytic Transglycosylase (LT) and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002537173.1 | 0 | 1 | 133 | 1 | 133 | lytic transglycosylase, putative [Ricinus communis] |
| RefSeq | YP_003050320.1 | 0 | 2 | 133 | 189 | 320 | Lytic transglycosylase catalytic [Methylovorus sp. SIP3-4] |
| RefSeq | YP_524996.1 | 0 | 2 | 133 | 194 | 325 | lytic transglycosylase, catalytic [Rhodoferax ferrireducens T118] |
| RefSeq | YP_547170.1 | 0 | 2 | 127 | 200 | 325 | lytic transglycosylase, catalytic [Polaromonas sp. JS666] |
| RefSeq | ZP_04764704.1 | 0 | 3 | 133 | 166 | 296 | Lytic transglycosylase catalytic [Acidovorax delafieldii 2AN] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1qte_A | 0.0000009 | 10 | 108 | 471 | 592 | A Chain A, Lip5(mit)2 |
| PDB | 1qsa_A | 0.0000009 | 10 | 108 | 471 | 592 | A Chain A, Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution |
| PDB | 1sly_A | 0.000001 | 10 | 108 | 471 | 592 | A Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A |
| PDB | 4hjv_E | 0.0008 | 3 | 43 | 50 | 90 | A Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A |
| PDB | 4hjv_D | 0.0008 | 3 | 43 | 50 | 90 | A Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EX918635 | 64 | 5 | 68 | 0.000001 |
| HO423184 | 108 | 23 | 111 | 0.0002 |
| EH222229 | 67 | 5 | 68 | 0.007 |
| FE625482 | 103 | 9 | 96 | 0.019 |
| GT022377 | 89 | 9 | 88 | 0.022 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_158766g0100 | MA_158760g0070 | MA_159146g0030 | MA_159036g0330 | |
| Ricinus communis | 28599.m000063 | 30692.m000027 | 33357.m000019 | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |