Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.006G068300.1 |
Family | GH37 |
Protein Properties | Length: 147 Molecular Weight: 16056 Isoelectric Point: 5.1915 |
Chromosome | Chromosome/Scaffold: 06 Start: 5111073 End: 5111804 |
Description | trehalase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH37 | 14 | 135 | 0 |
EDAALVENVMRSFQSSGLVHAAGIATSLINSGQQWDFPNGWAPLQHMIVEGLLRSGLKEARSLAEDIAVRWIKTNYIGYKKTGAMHEKYDVRKCGAFGGG GEYIPQTGFGWSNGVVLTFLEE |
Full Sequence |
---|
Protein Sequence Length: 147 Download |
ANTENALDFD HKCEDAALVE NVMRSFQSSG LVHAAGIATS LINSGQQWDF PNGWAPLQHM 60 IVEGLLRSGL KEARSLAEDI AVRWIKTNYI GYKKTGAMHE KYDVRKCGAF GGGGEYIPQT 120 GFGWSNGVVL TFLEEFGWPE DRSIGC* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK13272 | treA | 7.0e-26 | 31 | 137 | 107 | + trehalase; Provisional | ||
PRK13271 | treA | 4.0e-27 | 28 | 134 | 107 | + trehalase; Provisional | ||
COG1626 | TreA | 7.0e-30 | 28 | 142 | 116 | + Neutral trehalase [Carbohydrate transport and metabolism] | ||
pfam01204 | Trehalase | 8.0e-56 | 14 | 137 | 126 | + Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi. | ||
PLN02567 | PLN02567 | 6.0e-95 | 15 | 146 | 132 | + alpha,alpha-trehalase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004555 | alpha,alpha-trehalase activity |
GO:0005991 | trehalose metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD22970.1 | 0 | 15 | 146 | 426 | 557 | AF124148_1 trehalase 1 GMTRE1 [Glycine max] |
RefSeq | XP_002299445.1 | 0 | 7 | 146 | 428 | 565 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002303674.1 | 0 | 15 | 146 | 437 | 568 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002303675.1 | 0 | 7 | 146 | 431 | 568 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002518875.1 | 0 | 15 | 146 | 436 | 567 | alpha,alpha-trehalase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2wyn_D | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2wyn_C | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2wyn_B | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2wyn_A | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2jjb_D | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
trehalose degradation II (trehalase) | TREHALA-RXN | EC-3.2.1.28 | α,α-trehalase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DB897100 | 133 | 15 | 147 | 0 |
DT484056 | 133 | 15 | 147 | 0 |
CV272246 | 125 | 23 | 147 | 0 |
BU040338 | 133 | 15 | 147 | 0 |
DW352734 | 133 | 15 | 147 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|