| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.006G068300.1 |
| Family | GH37 |
| Protein Properties | Length: 147 Molecular Weight: 16056 Isoelectric Point: 5.1915 |
| Chromosome | Chromosome/Scaffold: 06 Start: 5111073 End: 5111804 |
| Description | trehalase 1 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH37 | 14 | 135 | 0 |
| EDAALVENVMRSFQSSGLVHAAGIATSLINSGQQWDFPNGWAPLQHMIVEGLLRSGLKEARSLAEDIAVRWIKTNYIGYKKTGAMHEKYDVRKCGAFGGG GEYIPQTGFGWSNGVVLTFLEE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 147 Download |
| ANTENALDFD HKCEDAALVE NVMRSFQSSG LVHAAGIATS LINSGQQWDF PNGWAPLQHM 60 IVEGLLRSGL KEARSLAEDI AVRWIKTNYI GYKKTGAMHE KYDVRKCGAF GGGGEYIPQT 120 GFGWSNGVVL TFLEEFGWPE DRSIGC* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK13272 | treA | 7.0e-26 | 31 | 137 | 107 | + trehalase; Provisional | ||
| PRK13271 | treA | 4.0e-27 | 28 | 134 | 107 | + trehalase; Provisional | ||
| COG1626 | TreA | 7.0e-30 | 28 | 142 | 116 | + Neutral trehalase [Carbohydrate transport and metabolism] | ||
| pfam01204 | Trehalase | 8.0e-56 | 14 | 137 | 126 | + Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi. | ||
| PLN02567 | PLN02567 | 6.0e-95 | 15 | 146 | 132 | + alpha,alpha-trehalase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004555 | alpha,alpha-trehalase activity |
| GO:0005991 | trehalose metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAD22970.1 | 0 | 15 | 146 | 426 | 557 | AF124148_1 trehalase 1 GMTRE1 [Glycine max] |
| RefSeq | XP_002299445.1 | 0 | 7 | 146 | 428 | 565 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002303674.1 | 0 | 15 | 146 | 437 | 568 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002303675.1 | 0 | 7 | 146 | 431 | 568 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002518875.1 | 0 | 15 | 146 | 436 | 567 | alpha,alpha-trehalase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2wyn_D | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2wyn_C | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2wyn_B | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2wyn_A | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2jjb_D | 2e-18 | 21 | 134 | 390 | 500 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| trehalose degradation II (trehalase) | TREHALA-RXN | EC-3.2.1.28 | α,α-trehalase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DB897100 | 133 | 15 | 147 | 0 |
| DT484056 | 133 | 15 | 147 | 0 |
| CV272246 | 125 | 23 | 147 | 0 |
| BU040338 | 133 | 15 | 147 | 0 |
| DW352734 | 133 | 15 | 147 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |