Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.model.supercontig_1398.1 |
Family | GH35 |
Protein Properties | Length: 101 Molecular Weight: 11803.7 Isoelectric Point: 9.1444 |
Chromosome | Chromosome/Scaffold: 1398 Start: 12929 End: 13630 |
Description | beta-galactosidase 17 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 13 | 100 | 4.30058e-42 |
FWKDGKPFRIIGGDLHYFRVLPEYWEDRLLRAKALGLNTIQTYVPWNLHEPKPGKLVFEGVADLVAFLKLCQKLDFVVMLRAGPYICG |
Full Sequence |
---|
Protein Sequence Length: 101 Download |
IETRKFKIDN DMFWKDGKPF RIIGGDLHYF RVLPEYWEDR LLRAKALGLN TIQTYVPWNL 60 HEPKPGKLVF EGVADLVAFL KLCQKLDFVV MLRAGPYICG X |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam02449 | Glyco_hydro_42 | 0.002 | 26 | 80 | 56 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
COG1874 | LacA | 7.0e-17 | 9 | 96 | 89 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
PLN03059 | PLN03059 | 6.0e-23 | 9 | 99 | 91 | + beta-galactosidase; Provisional | ||
pfam01301 | Glyco_hydro_35 | 2.0e-50 | 13 | 100 | 88 | + Glycosyl hydrolases family 35. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD55646.1 | 0 | 3 | 100 | 60 | 157 | AC008017_19 Similar to acid beta-galactosidase [Arabidopsis thaliana] |
EMBL | CBI35958.1 | 0 | 4 | 100 | 73 | 169 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_565051.1 | 0 | 3 | 100 | 60 | 157 | BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana] |
RefSeq | XP_002280228.1 | 0 | 4 | 100 | 49 | 145 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002527397.1 | 0 | 4 | 100 | 53 | 149 | beta-galactosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3thd_D | 4e-30 | 4 | 100 | 7 | 105 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
PDB | 3thd_C | 4e-30 | 4 | 100 | 7 | 105 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
PDB | 3thd_B | 4e-30 | 4 | 100 | 7 | 105 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
PDB | 3thd_A | 4e-30 | 4 | 100 | 7 | 105 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
PDB | 3thc_D | 4e-30 | 4 | 100 | 7 | 105 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
lactose degradation III | BETAGALACTOSID-RXN | EC-3.2.1.23 | β-galactosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FQ360436 | 100 | 1 | 100 | 0 |
EE089466 | 97 | 4 | 100 | 0 |
CB006830 | 97 | 4 | 100 | 0 |
DB890826 | 100 | 1 | 100 | 0 |
BQ403618 | 100 | 1 | 100 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|