y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSelaginella moellendorffii
Cazyme ID115361
FamilyPL1
Protein PropertiesLength: 325 Molecular Weight: 35262.9 Isoelectric Point: 6.2237
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1562280
  GNMTIFLQEMLWIRSMTTIDGRGFNVTITGRNLVLGGVSNVILHNLQISSVGESDTIHIYAGSKKIWVDHVSSWDARLGLVSVLQGSTDVTISNSLLTNP
  NFNMLLGASDADTEDKIMKVTVYRNWFKDSTQRMPHCRWGYCHVVNNLYTNWGYYAIGGRVNAKILSDNNVFV
Full Sequence
Protein Sequence     Length: 325     Download
CALGFAAGVV GGANGLAYVV TNPQDDDPKI PVPGTLRYGV SLGNSDGNGV WITFAGNMTI    60
FLQEMLWIRS MTTIDGRGFN VTITGRNLVL GGVSNVILHN LQISSVGESD TIHIYAGSKK    120
IWVDHVSSWD ARLGLVSVLQ GSTDVTISNS LLTNPNFNML LGASDADTED KIMKVTVYRN    180
WFKDSTQRMP HCRWGYCHVV NNLYTNWGYY AIGGRVNAKI LSDNNVFVAG RRSEVTPWFS    240
LHGPEFDTTA TITSSNDLFL NGSTFHQFMG VEPMSLTEVP PAYPTPDHNP PIHSTSTLPQ    300
FLEQCAGAIF GDSLARCMFA SSKV*                                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB3.0e-2865227178+
pfam00544Pec_lyase_C8.0e-4270227180+
smart00656Amb_all5.0e-5268231178+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI39737.1012865310unnamed protein product [Vitis vinifera]
RefSeqXP_001753505.1013178324predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001761530.10131715330predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001763554.10126547330predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002522747.10126571356Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0128924333A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0128924333A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A0.0000000000000265227127330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pe9_B0.0000000000016328180343A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pe9_A0.0000000000016328180343A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC9506092161023170
BJ867600225923150
BJ867266218903060
JG594056167261920
HO5922711861303100
Orthologous Group
SpeciesID
Physcomitrella patensPp1s9_110V6.1
Picea abiesMA_20455g0010
Selaginella moellendorffii920021360613694
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny