Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 115863 |
Family | CBM43 |
Protein Properties | Length: 108 Molecular Weight: 11648.9 Isoelectric Point: 7.2987 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 19 | 102 | 1.2e-32 |
WCVAKTDVDSRALLTALNYACGQGEADCKEISSPAGSCFQPNSLVSHASYAFNMFYHKYGRKPWNCDFGNTATLTATDPSYGSC |
Full Sequence |
---|
Protein Sequence Length: 108 Download |
MRGYKDGQQD HKLSSGNSWC VAKTDVDSRA LLTALNYACG QGEADCKEIS SPAGSCFQPN 60 SLVSHASYAF NMFYHKYGRK PWNCDFGNTA TLTATDPSYG SCTYPAL* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-16 | 18 | 91 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-34 | 18 | 104 | 87 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK25242.1 | 7e-26 | 15 | 104 | 401 | 488 | unknown [Picea sitchensis] |
GenBank | ABK95331.1 | 5e-26 | 19 | 105 | 368 | 452 | unknown [Populus trichocarpa] |
GenBank | ACU17645.1 | 2e-26 | 18 | 106 | 29 | 115 | unknown [Glycine max] |
RefSeq | XP_002282736.1 | 4e-26 | 14 | 105 | 372 | 461 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002518089.1 | 2e-27 | 15 | 106 | 23 | 112 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-26 | 18 | 106 | 12 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE486561 | 89 | 19 | 107 | 2e-29 |
FE486561 | 89 | 19 | 107 | 2e-29 |
FE461593 | 89 | 19 | 107 | 3e-29 |
FE486562 | 89 | 19 | 107 | 3e-29 |
FE497573 | 89 | 19 | 107 | 3e-29 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|