Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 16568 |
Family | GT1 |
Protein Properties | Length: 143 Molecular Weight: 16043.4 Isoelectric Point: 4.9695 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 4 | 137 | 1.6e-29 |
DWLDTQEPDSVLYVAFGSIAKLSQEEFEELALGLEASKVPFLLTVRPPQFVDEGDTTVLVKNSDFYKNFVERTKGRGLVVSWAPQREVLAHRAVAGFVSH CGWNSVLESVSSGVPIICWPRIYEQGLNRKIMAE |
Full Sequence |
---|
Protein Sequence Length: 143 Download |
ECLDWLDTQE PDSVLYVAFG SIAKLSQEEF EELALGLEAS KVPFLLTVRP PQFVDEGDTT 60 VLVKNSDFYK NFVERTKGRG LVVSWAPQRE VLAHRAVAGF VSHCGWNSVL ESVSSGVPII 120 CWPRIYEQGL NRKIMAERCR IGV |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02992 | PLN02992 | 4.0e-33 | 3 | 143 | 152 | + coniferyl-alcohol glucosyltransferase | ||
PLN03007 | PLN03007 | 5.0e-34 | 1 | 143 | 145 | + UDP-glucosyltransferase family protein | ||
PLN00164 | PLN00164 | 3.0e-34 | 1 | 131 | 132 | + glucosyltransferase; Provisional | ||
PLN02534 | PLN02534 | 2.0e-35 | 1 | 143 | 144 | + UDP-glycosyltransferase | ||
PLN02555 | PLN02555 | 5.0e-37 | 1 | 143 | 143 | + limonoid glucosyltransferase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACC38471.1 | 4e-39 | 1 | 143 | 253 | 400 | UDP-glycosyltransferase [Medicago truncatula] |
DDBJ | BAB68083.1 | 5e-39 | 1 | 143 | 260 | 402 | putative UDP-glycose:flavonoid glycosyltransferase [Oryza sativa Japonica Group] |
GenBank | EAY75734.1 | 4e-39 | 1 | 143 | 260 | 402 | hypothetical protein OsI_03646 [Oryza sativa Indica Group] |
GenBank | EAZ13452.1 | 3e-39 | 1 | 143 | 229 | 371 | hypothetical protein OsJ_03368 [Oryza sativa Japonica Group] |
RefSeq | NP_001043970.1 | 2e-39 | 1 | 143 | 264 | 411 | Os01g0697100 [Oryza sativa (japonica cultivar-group)] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2vg8_A | 5e-35 | 1 | 143 | 257 | 404 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vch_A | 5e-35 | 1 | 143 | 257 | 404 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vce_A | 5e-35 | 1 | 143 | 257 | 404 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c9z_A | 6e-33 | 2 | 143 | 261 | 390 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c1z_A | 6e-33 | 2 | 143 | 261 | 390 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
anthocyanin biosynthesis (delphinidin 3-O-glucoside) | RXN-7815 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | PELUDP-RXN | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE428804 | 143 | 1 | 143 | 0 |
FE451402 | 140 | 4 | 143 | 0 |
FE480333 | 137 | 7 | 143 | 0 |
FE480334 | 137 | 7 | 143 | 0 |
FE501737 | 132 | 12 | 143 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|