Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 27243 |
Family | GT1 |
Protein Properties | Length: 137 Molecular Weight: 15234.5 Isoelectric Point: 5.0898 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 7 | 134 | 1.3e-30 |
SWLDQKPPQSVVFICFGTLAENTLEQLQELASALEELTNQSFLWVLRPSQQSCLSEDFKRRTAARGKIVPWCSQLQVLSHPSIGGFVTHCGWNSILESLS CGVPMLGWPCLGEQSLNSKYLADVWKAG |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
DDVPVLSWLD QKPPQSVVFI CFGTLAENTL EQLQELASAL EELTNQSFLW VLRPSQQSCL 60 SEDFKRRTAA RGKIVPWCSQ LQVLSHPSIG GFVTHCGWNS ILESLSCGVP MLGWPCLGEQ 120 SLNSKYLADV WKAGTRI |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02562 | PLN02562 | 2.0e-32 | 1 | 137 | 137 | + UDP-glycosyltransferase | ||
PLN02173 | PLN02173 | 5.0e-33 | 1 | 137 | 139 | + UDP-glucosyl transferase family protein | ||
PLN00164 | PLN00164 | 1.0e-34 | 8 | 123 | 129 | + glucosyltransferase; Provisional | ||
PLN02554 | PLN02554 | 3.0e-35 | 5 | 124 | 134 | + UDP-glycosyltransferase family protein | ||
PLN02555 | PLN02555 | 3.0e-39 | 4 | 137 | 140 | + limonoid glucosyltransferase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK23573.1 | 1.99993e-41 | 8 | 137 | 6 | 140 | unknown [Picea sitchensis] |
GenBank | ABK24777.1 | 2e-38 | 8 | 137 | 283 | 416 | unknown [Picea sitchensis] |
GenBank | ABR17061.1 | 5e-38 | 8 | 137 | 268 | 401 | unknown [Picea sitchensis] |
GenBank | ACN39827.1 | 5e-39 | 8 | 137 | 287 | 420 | unknown [Picea sitchensis] |
GenBank | ACN40261.1 | 2e-39 | 8 | 137 | 159 | 292 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 8e-33 | 1 | 137 | 281 | 420 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c9z_A | 1e-30 | 6 | 137 | 262 | 392 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c1z_A | 1e-30 | 6 | 137 | 262 | 392 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c1x_A | 1e-30 | 6 | 137 | 262 | 392 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vg8_A | 6e-30 | 6 | 136 | 259 | 405 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
crocetin esters biosynthesis | RXN-8471 | EC-2.4.1.271 | crocetin glucosyltransferase |
crocetin esters biosynthesis | RXN-8473 | EC-2.4.1.271 | crocetin glucosyltransferase |
crocetin esters biosynthesis | RXN-8475 | EC-2.4.1.271 | crocetin glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE468260 | 138 | 1 | 137 | 0 |
FE468261 | 138 | 1 | 137 | 0 |
FE468261 | 138 | 1 | 137 | 0 |
FE468260 | 138 | 1 | 137 | 0 |
FE454895 | 93 | 45 | 137 | 1.4013e-45 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|