| Basic Information | |
|---|---|
| Species | Selaginella moellendorffii |
| Cazyme ID | 27278 |
| Family | GT1 |
| Protein Properties | Length: 150 Molecular Weight: 16764 Isoelectric Point: 4.497 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 5 | 142 | 2.3e-27 |
| DWLDTQEPDSVLYVAFGSSIAKLSQEEFEELALGLEASKVPFLLTVRPPQFVDEGDTTVLVKNSDFYKNFVERTKGRDLVVSWAPQREVLAHRAVAGFVS HCGWNSVLESVSSGVPIICWPRIYEEGLNRKIMAERCR | |||
| Full Sequence |
|---|
| Protein Sequence Length: 150 Download |
| SECLDWLDTQ EPDSVLYVAF GSSIAKLSQE EFEELALGLE ASKVPFLLTV RPPQFVDEGD 60 TTVLVKNSDF YKNFVERTKG RDLVVSWAPQ REVLAHRAVA GFVSHCGWNS VLESVSSGVP 120 IICWPRIYEE GLNRKIMAER CRIGVEVSDG |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN00164 | PLN00164 | 2.0e-30 | 2 | 133 | 133 | + glucosyltransferase; Provisional | ||
| PLN03007 | PLN03007 | 7.0e-31 | 2 | 147 | 148 | + UDP-glucosyltransferase family protein | ||
| PLN02992 | PLN02992 | 5.0e-31 | 4 | 149 | 157 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02534 | PLN02534 | 2.0e-32 | 1 | 147 | 148 | + UDP-glycosyltransferase | ||
| PLN02555 | PLN02555 | 4.0e-34 | 1 | 150 | 150 | + limonoid glucosyltransferase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACC38471.1 | 2e-36 | 2 | 145 | 253 | 400 | UDP-glycosyltransferase [Medicago truncatula] |
| DDBJ | BAB68083.1 | 1e-36 | 2 | 147 | 260 | 404 | putative UDP-glycose:flavonoid glycosyltransferase [Oryza sativa Japonica Group] |
| GenBank | EAY75734.1 | 1e-36 | 2 | 147 | 260 | 404 | hypothetical protein OsI_03646 [Oryza sativa Indica Group] |
| GenBank | EAZ13452.1 | 1e-36 | 2 | 147 | 229 | 373 | hypothetical protein OsJ_03368 [Oryza sativa Japonica Group] |
| RefSeq | NP_001043970.1 | 9e-37 | 2 | 147 | 264 | 413 | Os01g0697100 [Oryza sativa (japonica cultivar-group)] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 4e-33 | 1 | 150 | 256 | 409 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 2vch_A | 4e-33 | 1 | 150 | 256 | 409 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 2vce_A | 4e-33 | 1 | 150 | 256 | 409 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c9z_A | 6e-31 | 3 | 150 | 261 | 395 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c1z_A | 6e-31 | 3 | 150 | 261 | 395 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| anthocyanin biosynthesis (delphinidin 3-O-glucoside) | RXN-7815 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | PELUDP-RXN | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FE428804 | 149 | 2 | 150 | 0 |
| FE451402 | 145 | 5 | 149 | 0 |
| FE480333 | 142 | 8 | 149 | 0 |
| FE480334 | 142 | 8 | 149 | 0 |
| FE501737 | 137 | 13 | 149 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Selaginella moellendorffii | 49485 | 27279 | 16568 | 37475 | 26771 |
| 18145 | 111307 | 23005 | 113943 | 12792 | |
| 445219 | 35644 | 12509 | 427660 | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |