Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 29597.m000295 |
Family | CBM43 |
Protein Properties | Length: 114 Molecular Weight: 12935.8 Isoelectric Point: 6.2254 |
Chromosome | Chromosome/Scaffold: 29597 Start: 130293 End: 130941 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 29 | 108 | 1.4e-32 |
WCIADEQTPDGELQMALDWACGRGGADCSMIQVNKPCYFPNTVRDHASYAFNSYFQKFKHKSGSCYFKGAAMITELDPNT |
Full Sequence |
---|
Protein Sequence Length: 114 Download |
MSTFWLRIML ALLIMSITPP RSDGQLEQWC IADEQTPDGE LQMALDWACG RGGADCSMIQ 60 VNKPCYFPNT VRDHASYAFN SYFQKFKHKS GSCYFKGAAM ITELDPNTEL KAHF 120 |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 3.0e-21 | 28 | 100 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 3.0e-35 | 28 | 106 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN67352.1 | 0 | 18 | 108 | 18 | 108 | hypothetical protein [Vitis vinifera] |
EMBL | CBI28425.1 | 0 | 18 | 107 | 18 | 107 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002321180.1 | 0 | 1 | 107 | 1 | 107 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 0 | 10 | 107 | 10 | 107 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
RefSeq | XP_002531703.1 | 0 | 1 | 114 | 1 | 114 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000001 | 18 | 106 | 2 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |