y PlantCAZyme

CAZyme Information

Basic Information
SpeciesRicinus communis
Cazyme ID29742.m001446
FamilyGH18
Protein PropertiesLength: 938 Molecular Weight: 104030 Isoelectric Point: 8.5717
ChromosomeChromosome/Scaffold: 29742 Start: 529418 End: 542803
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH181904231.4e-31
  DYVIELLVSECKEMEYDGIVLESWSRWQGYLILHDLKTRKKALQFIKQLADALHSVSSTRNIKQHLQLIYVIGPPHSEKFQPYDFGPQDLQSLSDAVDGF
  SLMTYDFSSPNNPGPNAPLKWIHHVLQLLLGASSNGARAPAYKIFLGISFYGNDFHFSKGSGGGAIVGRDYLSLLEKHKPKLQWEKNSGEHFFLYVDDED
  TKHLVFYPSLMSLSLRLDEARLWGTGVSIWEIGQ
Full Sequence
Protein Sequence     Length: 938     Download
MAKTRNRRVT QGSDSTEKRV GRTQAQVNEP ADSAASNRKL IAVFVFFFIV IPAASVLVYH    60
IKCPSNTNNT RRQQSLIQAD VNYQDILTEH SKVSKNASHR EFTHPVLAYV TPWNAKGYEM    120
AKRFTNKFTH LSPVWYDLKS KGSELILEGR HNADRGWLSE IRKNGDALVL PRVVLEAFPM    180
EMLIKKNVTD YVIELLVSEC KEMEYDGIVL ESWSRWQGYL ILHDLKTRKK ALQFIKQLAD    240
ALHSVSSTRN IKQHLQLIYV IGPPHSEKFQ PYDFGPQDLQ SLSDAVDGFS LMTYDFSSPN    300
NPGPNAPLKW IHHVLQLLLG ASSNGARAPA YKIFLGISFY GNDFHFSKGS GGGAIVGRDY    360
LSLLEKHKPK LQWEKNSGEH FFLYVDDEDT KHLVFYPSLM SLSLRLDEAR LWGTGVSIWE    420
IGQGLDYFFD LLPLNFHYSL VWKCTVPGDD FRFVNMQMKW SLNLLIHNFF VFMVIMKSVF    480
DRQIVWCPVL LFCTVEYLVF LTKNYAMEAL NAAGLTPISV LCEKRNEPRK IWCPPTSPLK    540
FSGSAPLSTT SLSLQDCLSR SYSGSLVVLS SVLSTGLAKA LTYEEALQQS AGTAASESDA    600
SGVLDNVISF ATENPVVIAG GAVVLAVPLI LSQILKKPKS WGVESAKKAY ALLGDDANAQ    660
LLDIRAPVEL RKVGTPDIRG FKKKPVPISY NGEDKTGFLK RLSLKFKEPE NTTLFILDKY    720
DGNSELVAEL VTVNGFKAAY AIKDGAEGPK GWTNSSLPWI PPSKTLSFDL SSLTDAFSIG    780
VCAFPIHSFY CKVFTFDGGF FSLLQIETIL QVLGSAAIIQ FASKKLLYAE ERKQTLKQVD    840
EFLNTKIAPK ELADEIKQIG KALLPSTTTN KALPPPAEAS SEPAAAENTV QKAEAVAEPA    900
PQINSAKAGS VSGFSRPLSP YASYPDLKPP TSPTPSQP                            960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00704Glyco_hydro_181.0e-11233423211+
COG3858COG38583.0e-20192436250+
cd02874GH18_CFLE_spore_hydrolase4.0e-26106432349+
smart00636Glyco_188.0e-28106423351+
cd02876GH18_SI-CLP6.0e-143102432336+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB61039.106787791853A_IG002N01.31 gene product [Arabidopsis thaliana]
EMBLCBI40499.1014321435unnamed protein product [Vitis vinifera]
RefSeqNP_192013.106743265430glycosyl hydrolase family 18 protein [Arabidopsis thaliana]
RefSeqXP_002320856.107243240399predicted protein [Populus trichocarpa]
RefSeqXP_002523373.1019281928chitinase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3bxw_A07243246393B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp
PDB3bxw_B07243246393B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp
PDB2dcq_A06467659128B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp
PDB1vee_A06467659128A Chain A, Nmr Structure Of The Hypothetical Rhodanese Domain At4g01050 From Arabidopsis Thaliana
PDB3cz8_B0.000001272421166308A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis
Transmembrane Domains
StartEnd
4059
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG6581512681374040
DY27458236113580
EE2604853005308280
EG6586292465027470
EG658151174064220.28
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00129.1
Arabidopsis lyrata352729
Arabidopsis thalianaAT4G01040.1
Brachypodium distachyonBradi2g43770.1
Brassica rapaBra000939
Carica papayaevm.model.supercontig_273.9
Capsella rubellaCarubv10001405m
Chlamydomonas reinhardtiiCre03.g200650.t1.1
Citrus clementinaCiclev10020231m
Citrus sinensisorange1.1g014108morange1.1g014001m
Cucumis sativusCucsa.259130.2Cucsa.259130.1
Eucalyptus grandisEucgr.E00067.1
Fragaria vescamrna19212.1-v1.0-hybrid
Glycine maxGlyma03g41760.2Glyma19g44401.1Glyma03g41760.1
Gossypium raimondiiGorai.008G124300.1
Linum usitatissimumLus10005946Lus10029447
Malus domesticaMDP0000223446MDP0000126058
Manihot esculentacassava4.1_001521m
Medicago truncatulaMedtr5g025480.1
Mimulus guttatusmgv1a010899m
Oryza sativaLOC_Os01g43220.1
Panicum virgatumPavirv00054484mPavirv00033212m
Physcomitrella patensPp1s162_65V6.1
Phaseolus vulgarisPhvul.006G111900.1
Picea abiesMA_557825g0010
Populus trichocarpaPotri.014G096700.1Potri.014G096700.2Potri.014G096700.4Potri.014G096700.3
Prunus persicappa006146m
Setaria italicaSi002099m
Selaginella moellendorffii249085240
Sorghum bicolorSb03g028160.1
Thellungiella halophilaThhalv10028671m
Vitis viniferaGSVIVT01027076001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny