Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 34675.m000028 |
Family | GT4 |
Protein Properties | Length: 137 Molecular Weight: 13595.2 Isoelectric Point: 4.5185 |
Chromosome | Chromosome/Scaffold: 34675 Start: 879 End: 1292 |
Description | sulfoquinovosyldiacylglycerol 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT4 | 7 | 99 | 1.4e-21 |
IFAGFKTGEALGQALASGDVFFNPSVTETFGNVTLEAMASGLPVVAAGATGSASLVADGVTGRLVAPSGSMTTDAAAFAAALAPYCSDPALRA |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
TNLPGGIFAG FKTGEALGQA LASGDVFFNP SVTETFGNVT LEAMASGLPV VAAGATGSAS 60 LVADGVTGRL VAPSGSMTTD AAAFAAALAP YCSDPALRAA HGAAGEARAC EYSWEAINAV 120 VADTYVQLVG ERRKARG |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02871 | PLN02871 | 1.0e-17 | 7 | 73 | 70 | + UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | ||
cd03798 | GT1_wlbH_like | 5.0e-18 | 7 | 73 | 67 | + This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS. | ||
cd03801 | GT1_YqgM_like | 3.0e-19 | 7 | 73 | 67 | + This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea. | ||
TIGR00032 | argG | 5.0e-22 | 7 | 74 | 68 | + argininosuccinate synthase. argG in bacteria, ARG1 in Saccharomyces cerevisiae. There is a very unusual clustering in the alignment, with a deep split between one cohort of E. coli, H. influenzae, and Streptomyces, and the other cohort of eukaryotes, archaea, and the rest of the eubacteria [Amino acid biosynthesis, Glutamate family]. | ||
TIGR00009 | L28 | 4.0e-31 | 3 | 125 | 123 | + ribosomal protein L28. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture and are not included [Protein synthesis, Ribosomal proteins: synthesis and modification]. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002538023.1 | 0 | 1 | 137 | 1 | 137 | conserved hypothetical protein [Ricinus communis] |
RefSeq | YP_457279.1 | 0 | 3 | 128 | 258 | 378 | glycosyltransferase [Erythrobacter litoralis HTCC2594] |
RefSeq | YP_497814.1 | 9.99995e-41 | 2 | 132 | 269 | 394 | glycosyl transferase, group 1 [Novosphingobium aromaticivorans DSM 12444] |
RefSeq | ZP_01038877.1 | 0 | 3 | 133 | 258 | 391 | glycosyltransferase [Erythrobacter sp. NAP1] |
RefSeq | ZP_01864880.1 | 2.99878e-43 | 3 | 132 | 258 | 386 | glycosyltransferase [Erythrobacter sp. SD-21] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2gek_A | 0.0000000006 | 20 | 125 | 279 | 380 | A Chain A, Beta-N-Acetylhexosaminidase Mutant D539a Complexed With Di- N-Acetyl-Beta-D-Glucosamine (Chitobiase) |
PDB | 2gej_A | 0.0000000006 | 20 | 125 | 279 | 380 | A Chain A, Crystal Structure Of Phosphatidylinositol Mannosyltransferase (Pima) From Mycobacterium Smegmatis In Complex With Gdp-Man |
PDB | 3c48_B | 0.0000009 | 25 | 125 | 327 | 422 | A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure. |
PDB | 3c48_A | 0.0000009 | 25 | 125 | 327 | 422 | A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure. |
PDB | 3c4v_B | 0.000001 | 25 | 125 | 307 | 402 | A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure. |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FG600821 | 128 | 2 | 129 | 1e-24 |
GE189371 | 130 | 7 | 136 | 0.000000000000003 |
HO610474 | 67 | 7 | 73 | 0.000000000000007 |
HO618467 | 67 | 7 | 73 | 0.000000000000009 |
HO597833 | 67 | 7 | 73 | 0.00000000000002 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|