| Basic Information | |
|---|---|
| Species | Selaginella moellendorffii |
| Cazyme ID | 37475 |
| Family | GT1 |
| Protein Properties | Length: 123 Molecular Weight: 13621.5 Isoelectric Point: 4.428 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 4 | 123 | 1.2e-26 |
| DWLDTQEPDSVLYVAFGSIAKLSQEEFEELALGLEASKVPFLLTVRPPQFVDEGDTTVLVKNSDFYKNLVERTKGRGLVVSWAPQREVLAHRAVAGFVSH CGWNSVLESVSSGVPIICWP | |||
| Full Sequence |
|---|
| Protein Sequence Length: 123 Download |
| ECLDWLDTQE PDSVLYVAFG SIAKLSQEEF EELALGLEAS KVPFLLTVRP PQFVDEGDTT 60 VLVKNSDFYK NLVERTKGRG LVVSWAPQRE VLAHRAVAGF VSHCGWNSVL ESVSSGVPII 120 CWP |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02534 | PLN02534 | 1.0e-28 | 1 | 123 | 124 | + UDP-glycosyltransferase | ||
| PLN02992 | PLN02992 | 8.0e-29 | 3 | 123 | 132 | + coniferyl-alcohol glucosyltransferase | ||
| PLN03007 | PLN03007 | 2.0e-29 | 1 | 123 | 125 | + UDP-glucosyltransferase family protein | ||
| PLN00164 | PLN00164 | 7.0e-31 | 1 | 123 | 124 | + glucosyltransferase; Provisional | ||
| PLN02555 | PLN02555 | 1.0e-34 | 1 | 123 | 123 | + limonoid glucosyltransferase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001043970.1 | 7e-35 | 1 | 123 | 264 | 391 | Os01g0697100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002323185.1 | 3e-35 | 1 | 123 | 292 | 406 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525851.1 | 8e-35 | 1 | 123 | 284 | 398 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| RefSeq | XP_002525853.1 | 3e-37 | 1 | 123 | 279 | 393 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| RefSeq | XP_002526116.1 | 6e-35 | 2 | 123 | 292 | 405 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 2e-31 | 1 | 123 | 284 | 398 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vg8_A | 6e-31 | 1 | 123 | 257 | 384 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vch_A | 6e-31 | 1 | 123 | 257 | 384 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vce_A | 6e-31 | 1 | 123 | 257 | 384 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2c9z_A | 5e-29 | 2 | 123 | 261 | 370 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| cytokinins-O-glucoside biosynthesis | RXN-4723 | EC-2.4.1.203 | trans-zeatin O-β-D-glucosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FE428804 | 123 | 1 | 123 | 0 |
| FE451402 | 120 | 4 | 123 | 0 |
| FE480333 | 117 | 7 | 123 | 0 |
| FE480334 | 117 | 7 | 123 | 0 |
| FE501737 | 112 | 12 | 123 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Selaginella moellendorffii | 49485 | 27279 | 16568 | 27278 | 26771 |
| 18145 | 111307 | 23005 | 113943 | 12792 | |
| 445219 | 35644 | 12509 | 427660 | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |