Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 38965 |
Family | CBM43 |
Protein Properties | Length: 107 Molecular Weight: 11800.3 Isoelectric Point: 6.4691 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 31 | 107 | 3.1e-28 |
WCVANPAVPPDSLQKGLDYACSQVDCSAIQYTGNCVYPDNIHAHASWVYNYYFQMKARYDYNCYFDNTALISSTDPS |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
VAFFLSFAVS VLLARAAAPQ PSGRVVNGKV WCVANPAVPP DSLQKGLDYA CSQVDCSAIQ 60 YTGNCVYPDN IHAHASWVYN YYFQMKARYD YNCYFDNTAL ISSTDPS |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 2.0e-14 | 31 | 99 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 4.0e-27 | 31 | 107 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG25091.1 | 8e-21 | 1 | 107 | 9 | 115 | glucan endo-1,3-beta-glucosidase precursor [Zea mays] |
GenBank | EAZ05508.1 | 8e-21 | 15 | 107 | 52 | 148 | hypothetical protein OsI_27724 [Oryza sativa Indica Group] |
RefSeq | NP_001060942.1 | 4e-21 | 29 | 107 | 40 | 121 | Os08g0135500 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001141170.1 | 3e-21 | 1 | 107 | 9 | 115 | hypothetical protein LOC100273256 [Zea mays] |
RefSeq | XP_002443816.1 | 2e-22 | 1 | 107 | 9 | 114 | hypothetical protein SORBIDRAFT_07g002710 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-18 | 17 | 107 | 1 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |