y
Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 38969 |
Family | CBM43 |
Protein Properties | Length: 79 Molecular Weight: 8985.02 Isoelectric Point: 4.3432 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 4 | 79 | 1.4e-26 |
CIANPTIPPDMLQRGLDYACSQVDCSAIQFDGPCSYPNSIYSHASWAYNLYFQMKARYDYNCYFDNTALISSTDPS |
Full Sequence |
---|
Protein Sequence Length: 79 Download |
KVYCIANPTI PPDMLQRGLD YACSQVDCSA IQFDGPCSYP NSIYSHASWA YNLYFQMKAR 60 YDYNCYFDNT ALISSTDPS 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-12 | 3 | 71 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-25 | 3 | 79 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG26564.1 | 2e-20 | 1 | 79 | 74 | 152 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
GenBank | ACG36169.1 | 1e-20 | 1 | 79 | 24 | 102 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
GenBank | ACG39487.1 | 2e-20 | 1 | 79 | 37 | 115 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
RefSeq | XP_002446660.1 | 1e-20 | 1 | 79 | 37 | 115 | hypothetical protein SORBIDRAFT_06g020000 [Sorghum bicolor] |
RefSeq | XP_002454863.1 | 2e-20 | 1 | 79 | 38 | 116 | hypothetical protein SORBIDRAFT_03g000270 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-16 | 3 | 79 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL297369 | 79 | 1 | 79 | 5e-21 |
FL297369 | 79 | 1 | 79 | 5e-21 |
CA075967 | 79 | 1 | 79 | 6e-21 |
CA153410 | 79 | 1 | 79 | 6e-21 |
CA247524 | 79 | 1 | 79 | 6e-21 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|