CAZyme Information

Basic Information
SpeciesSelaginella moellendorffii
Cazyme ID437348
FamilyGH13
Protein PropertiesLength: 1133 Molecular Weight: 127718 Isoelectric Point: 6.2958
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133456679.9e-28
  LPRIKGLGYNAVQLMAVMEHAYYGSFGYHITNFFAVSSRCGTPDELKSLIDKAHELGLFVLMDVVHSHCSNNVLDGLNMFDGTDSQYFHSGARGYHWMWD
  SRLFDYSSWEVLRFLLSNLRWWMEEYKFDGFRFDGITSMMYTHHGLQMTFTGQYSEYFGMTTDVDAVVYLMLANDLLHALYPQTITVAEDVSGMPTLCIP
  VADGGIGFDYRLQMAIADKWIDILEKLKDEEWNMGNIVFTLTNRRWMEKCISYAESHDQALVGDKTLAFWLMDKDMYDHMALDRPSTPRIDRGIALHKMI
  RLITMALGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 1133     Download
MAWSVTQAPA GRASCICPRG IGGSGGIGAA ASSSQALRSS ARRRKRVALC CGSPLLGRAL    60
SLSCHVHGKH YSRPSTRVSC ADPVSPAEST AASTATASKD LLEPSKADHS MEEQTMEIAK    120
QIQAFRDGSL KLKEQDAALP KVVPPPGDGQ RIYEIDPYLK NYRDHLEYRY SQYKAKVDAI    180
NKHEGGLEAF SRGYEKFGFN RTAAGITYRE WAPAAKSASL MGDFNNWNPN ADMMKKNEYG    240
VWELFLPNNA DGSAAIPHGS RVKIHMETAS GVKDAIPAWI KFAVQAPGEI PYNGIYYDPP    300
PEERYEFKHP RPKRPNSLRV YEAHVGMSST EPKVNSYSAF RDDVLPRIKG LGYNAVQLMA    360
VMEHAYYGSF GYHITNFFAV SSRCGTPDEL KSLIDKAHEL GLFVLMDVVH SHCSNNVLDG    420
LNMFDGTDSQ YFHSGARGYH WMWDSRLFDY SSWEVLRFLL SNLRWWMEEY KFDGFRFDGI    480
TSMMYTHHGL QMTFTGQYSE YFGMTTDVDA VVYLMLANDL LHALYPQTIT VAEDVSGMPT    540
LCIPVADGGI GFDYRLQMAI ADKWIDILEK LKDEEWNMGN IVFTLTNRRW MEKCISYAES    600
HDQALVGDKT LAFWLMDKDM YDHMALDRPS TPRIDRGIAL HKMIRLITMA LGGEGYLNFM    660
GNEFGHPEWI DFPRSDQKLP NGKFVPGNKN SFDKCRRRFD LGDADYLRYR GLQEFDRAMQ    720
QLEAKYEFMV APHEYVSRKN EGDKIIVFEK GDLVFVFNFH WQKSYTDYRV GCLKPGNYKV    780
VLDTDERLFG GFGRLDHSAV FHTNEGWYDD RPQSFQVYSP CRTAVVYAPG LSQRVAMADS    840
SWDDAALITA FNSAVGKYQE RHSSKESDGK SSHQEKIESA SQQDQAAAEG SSQHADSSFV    900
DPSSYYPYPY PQPHPSYPYP AFVYPVPAYA CAPPPSHCCH HSCCHSSSTQ SSRSDDPSFE    960
TLKLAILQSL SQLPPDKQLS LEDNAEVLIA WFNAGFRTAR SPSRVVPISL FLIYWAERWL    1020
DQGFLPRTSE SKKEAFRKYL EASGVLDSLT KVLVALYEEN DKPPLAIDFI QHNLGGYTNE    1080
EYTKLKGERD ELQLKYNELV AAHEELGRKF EELQLQLPPP EEAPPVEGAP PA*           1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029602.0e-616024693+
PLN03244PLN032442.0e-137255827577+
PLN02447PLN024470104829729+
cd11321AmyAc_bac_euk_BE0301717417+
PLN02960PLN029600255827576+
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A015282713690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A015282713690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B015282713690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A015282713690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3k1d_A5.60519e-4516882995721A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)