y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID471336
FamilyGT76
Protein PropertiesLength: 495 Molecular Weight: 55983.6 Isoelectric Point: 9.471
ChromosomeChromosome/Scaffold: 1 Start: 4763451 End: 4766094
Descriptiontransferases, transferring hexosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT76184940
  IKYAIFSRLLVLFLTILWRSLLQPYDTSAALNPPCLYHKEDSPPFLVANATSRSLENSVVWDSVYFLRITECGYEYEQTYAFLPLLPFFISLFSRTVFAP
  LVPLIGLRAVMVLSGYIVSNLAFILAAIYLFRLSVIILKDSEASFRASIVFCFNPASIFYSSIYSESLYALFSIGGVYHLLSGTSNVAVLWLALSGCARS
  NGVLNAGYICFQTMHRAYEALYQKRRTYVSYKYLAMQVLVAGFLRCVCICLPFVAFQAYGYYNLCHGRTLDEMRPWCKGRIPLLYNFIQSHYWGVGFLKY
  FQFKQLPNFLLASPILSLAVCSIMSYMKSRPELFISLGFQATEKEKRSVAGLYSLKDAVKPNVKTSTNEGNRDIRQRKPSSKKDVTVTKVAPEKSGYFSA
  DVFPFIVHLGLMATTAFFIMHVQVATRFLSASPPLYWFASSLIASPEHSKWGYLIWSYCAAYILLGTLLFSNFYPFT
Full Sequence
Protein Sequence     Length: 495     Download
MAISMESSSK SRKETVLIKY AIFSRLLVLF LTILWRSLLQ PYDTSAALNP PCLYHKEDSP    60
PFLVANATSR SLENSVVWDS VYFLRITECG YEYEQTYAFL PLLPFFISLF SRTVFAPLVP    120
LIGLRAVMVL SGYIVSNLAF ILAAIYLFRL SVIILKDSEA SFRASIVFCF NPASIFYSSI    180
YSESLYALFS IGGVYHLLSG TSNVAVLWLA LSGCARSNGV LNAGYICFQT MHRAYEALYQ    240
KRRTYVSYKY LAMQVLVAGF LRCVCICLPF VAFQAYGYYN LCHGRTLDEM RPWCKGRIPL    300
LYNFIQSHYW GVGFLKYFQF KQLPNFLLAS PILSLAVCSI MSYMKSRPEL FISLGFQATE    360
KEKRSVAGLY SLKDAVKPNV KTSTNEGNRD IRQRKPSSKK DVTVTKVAPE KSGYFSADVF    420
PFIVHLGLMA TTAFFIMHVQ VATRFLSASP PLYWFASSLI ASPEHSKWGY LIWSYCAAYI    480
LLGTLLFSNF YPFT*                                                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5542COG55422.0e-15122333214+
pfam04188Mannosyl_trans22.0e-1942249483+
pfam04188Mannosyl_trans29.0e-13011365356+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC17633.1014941492Contains similarity to hypothetical protein C18b11.05 gb
RefSeqNP_172652.2014941489transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002283435.10104948497PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002304011.1014941483predicted protein [Populus trichocarpa]
RefSeqXP_002527781.1084943500conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
2139
97119
126148
185207
251273
326343
419441
471493
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BX83952729912990
BX841244319373550
EV114632248573030
DY964854278853620
BX841244371370.00000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00449.3Aquca_013_00449.2Aquca_013_00449.1
Arabidopsis thalianaAT1G11880.1
Brachypodium distachyonBradi4g06960.1
Brassica rapaBra031787Bra016807
Carica papayaevm.model.supercontig_1833.2
Capsella rubellaCarubv10008966m
Chlamydomonas reinhardtiiCre07.g320650.t1.3
Citrus clementinaCiclev10015009m
Citrus sinensisorange1.1g018572morange1.1g020868morange1.1g022022morange1.1g011059m
Cucumis sativusCucsa.142860.1Cucsa.142850.1
Eucalyptus grandisEucgr.F02225.1
Fragaria vescamrna24756.1-v1.0-hybrid
Glycine maxGlyma07g34710.2Glyma07g34710.1
Gossypium raimondiiGorai.011G002800.4.154.470Gorai.011G002800.6Gorai.011G002800.3Gorai.011G002800.2Gorai.011G002800.4.154.470
Gorai.011G002800.5Gorai.011G002800.4.21.155Gorai.011G002800.1Gorai.011G002800.4.21.155
Linum usitatissimumLus10000535
Malus domesticaMDP0000302238MDP0000268496MDP0000210920MDP0000206274MDP0000255613
MDP0000165902
Manihot esculentacassava4.1_021982mcassava4.1_013936m
Medicago truncatulaMedtr4g084070.1
Mimulus guttatusmgv1a006152m
Oryza sativaLOC_Os12g31480.1
Panicum virgatumPavirv00004639mPavirv00008794m
Physcomitrella patensPp1s58_115V6.1
Phaseolus vulgarisPhvul.002G098000.2Phvul.009G191800.1Phvul.002G098000.1
Picea abiesMA_93868g0010MA_10427477g0010
Populus trichocarpaPotri.003G216900.1Potri.003G216900.3Potri.003G216900.2Potri.003G216900.4Potri.003G216900.5
Prunus persicappa004654m
Ricinus communis29692.m000527
Setaria italicaSi021856m
Selaginella moellendorffii268247
Sorghum bicolorSb03g024000.1
Thellungiella halophilaThhalv10007452m
Vitis viniferaGSVIVT01025407001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny