y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID473529
FamilyGH116
Protein PropertiesLength: 948 Molecular Weight: 105676 Isoelectric Point: 6.5465
ChromosomeChromosome/Scaffold: 1 Start: 15604322 End: 15610211
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165208810
  GQFLYLEGIQYLMYNTYDVHFYSSFALLMLFPKLELSIQRDFAAAVLMHDSSKKQVMSSGEFVTRKALGAVPHDIGLNDPWFEVNAYNLFNTDRWKDLNS
  KFVLQVYRDVVATGDLNFAKAVWPSVYTAIAYLDQFDKDGDGMIENEGFPDQTYDAWSCSGVSAYCGGLWVAALQAGSALAREVGDNGAAVYFNAKYEKA
  RSVYEKLWNGSYFNYDNSRSGSSSSILADQLAGQWYARACGLKPIAKEEWIKKALETVYDFNVMRVRDGTRGAVNGMLPDGRVDTSTMVSREVWAGTTYS
  VAACMIQEGLADKGFRTASGIYEAAWSDRGLGCAFQTPEAWTTNDEFRSLCYMRPLAIWGIQ
Full Sequence
Protein Sequence     Length: 948     Download
MQNVPEDQNQ MVIDDKLPPF SWERKLNSQA KTPSEFKLSK RDHLHLFPLG YRLWRHTKDE    60
AAKGRASIFD IFRKHHITGD HGVPLGGIGA GSIGRSYKGE FQQFKLFPKI CEEAPILTNQ    120
FSAFVSRPGG VKHSTVLCPS KPQVIKDNGG YLCKGQVPNI GIESWDWNMT GEKSTYHALY    180
PRSWTVYDGE PDPELRIVSR QVSPFIPHNY EESSLPVSVF NFTVTNTGAE QAIVTLLFTW    240
ENSVGGASGL TGQHFNSTMK AKDGVHAVAL QHKTANGHPP VSYAIAAKET EDVRVSSCPC    300
FIVSGTTPNK ITAGDMWDEI KKNASFDKLT SNACSPSKPG TSIGAAIAAK VKVPPGCDRT    360
VTFSLSWDCP EARFDEKTYH RRYTRFYGSL GNAAVAMAHD ALLNFSEWET QIEEWQAPIL    420
ADTTLPEWYR ITLFNELYYF NSGGTMWTDG LPPKQSLDSI GRRKISLSIS TTDNTDPDQN    480
DIALDILGRI DAVCSQIHAP LSSNAALGTT MIQNTSENIG QFLYLEGIQY LMYNTYDVHF    540
YSSFALLMLF PKLELSIQRD FAAAVLMHDS SKKQVMSSGE FVTRKALGAV PHDIGLNDPW    600
FEVNAYNLFN TDRWKDLNSK FVLQVYRDVV ATGDLNFAKA VWPSVYTAIA YLDQFDKDGD    660
GMIENEGFPD QTYDAWSCSG VSAYCGGLWV AALQAGSALA REVGDNGAAV YFNAKYEKAR    720
SVYEKLWNGS YFNYDNSRSG SSSSILADQL AGQWYARACG LKPIAKEEWI KKALETVYDF    780
NVMRVRDGTR GAVNGMLPDG RVDTSTMVSR EVWAGTTYSV AACMIQEGLA DKGFRTASGI    840
YEAAWSDRGL GCAFQTPEAW TTNDEFRSLC YMRPLAIWGI QWAHTMPQPN REQEVSLKQQ    900
EEDATSVLFQ QHAGFIKVAH YLKNTKGKDH RNRLQTAYET FLRVIRL*                 960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.0005588736163+
COG4354COG43547.0e-3180449393+
pfam12215GBA2_N4.0e-6582408340+
COG4354COG43542.0e-72519880381+
pfam04685DUF6082.0e-172520882367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF97289.1012394723790AC010164_11 Hypothetical protein [Arabidopsis thaliana]
GenBankAAM19831.10694710922AT4g10060/T5L19_190 [Arabidopsis thaliana]
GenBankAAO42222.1019471947unknown protein [Arabidopsis thaliana]
RefSeqNP_174631.2019471947catalytic/ glucosylceramidase [Arabidopsis thaliana]
RefSeqNP_192744.60694710922catalytic/ glucosylceramidase [Arabidopsis thaliana]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2920403775339060
JG7030273285388650
FC9176483065338380
FC8953223033976950
DY2680963104317360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)