CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID478409
FamilyGH51
Protein PropertiesLength: 677 Molecular Weight: 74816.3 Isoelectric Point: 5.3065
ChromosomeChromosome/Scaffold: 3 Start: 4304991 End: 4309417
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512146650
  SARLQLTTTKKGSIWIDQVSAMPVDTYKGHGFRNDLFQMMVDIKPRFIRFPGGCFVEGEWLSNAFRWKETVGPWEERPGHFGDVWKYWTDDGLGHFEFFQ
  MAEDIGAAPIWVFNNGISHNDEVETASIMPFVQEALDGIEFARGDANSTWGSVRAKMGRQEPFELKYVAIGNEDCGKTYYRGNYIVFYNAIKKAYPDIKI
  ISNCDGSSHPLDHPADYYDYHIYTSASNLFSMYHQFDRTSRSGPKAFVSEYAVTGKDAGTGSLLASLAEAAFLIGLEKNSDIVEMASYAPLFVNTNDRRW
  NPDAIVFNSSHLYGTPSYWVQRFFAESSGATLLTSTLKGNSTSLVASAISWENNGKDYIRIKAVNFGANSVNMKVLVTGLDPNVMRVTGSKKTVLTSTNV
  MDENSFSQPEKVVPHESLLEMAEEDMTVVLPPHSFSSFDLLKESAKIKMPIS
Full Sequence
Protein Sequence     Length: 677     Download
MESWKLLRSV CLLSFLLGSC FVYQSLRVVD AQEDPKPAVT LQVDASNGAG RPIPDTLFGI    60
FFEEINHAGA GGLWAELVSN RGFEAGGQNT PSNIWPWSIV GDHSSIYVAT DRSSCFERNK    120
IALRMDVLCD SKDCPSGGVG VYNPGYWGMN IEEGKKYKVA LYVRSTGDID VSVSLTSSNG    180
SLTLASEKII ASASDVSKWI KKEVLLEAKS TDPSARLQLT TTKKGSIWID QVSAMPVDTY    240
KGHGFRNDLF QMMVDIKPRF IRFPGGCFVE GEWLSNAFRW KETVGPWEER PGHFGDVWKY    300
WTDDGLGHFE FFQMAEDIGA APIWVFNNGI SHNDEVETAS IMPFVQEALD GIEFARGDAN    360
STWGSVRAKM GRQEPFELKY VAIGNEDCGK TYYRGNYIVF YNAIKKAYPD IKIISNCDGS    420
SHPLDHPADY YDYHIYTSAS NLFSMYHQFD RTSRSGPKAF VSEYAVTGKD AGTGSLLASL    480
AEAAFLIGLE KNSDIVEMAS YAPLFVNTND RRWNPDAIVF NSSHLYGTPS YWVQRFFAES    540
SGATLLTSTL KGNSTSLVAS AISWENNGKD YIRIKAVNFG ANSVNMKVLV TGLDPNVMRV    600
TGSKKTVLTS TNVMDENSFS QPEKVVPHES LLEMAEEDMT VVLPPHSFSS FDLLKESAKI    660
KMPISDSSSH QKTTTV* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA0.0005491649178+
COG3534AbfA4.0e-30244389146+
pfam06964Alpha-L-AF_C2.0e-39487647171+
smart00813Alpha-L-AF_C7.0e-48462647199+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK50089.1016763678AF372949_1 AT3g10740/T7M13_18 [Arabidopsis thaliana]
GenBankAAO92261.1016763678alpha-L-arabinofuranosidase [Arabidopsis thaliana]
RefSeqNP_187685.1016763678ASD1 (ALPHA-L-ARABINOFURANOSIDASE 1); alpha-N-arabinofuranosidase/ hydrolase, acting on glycosyl bonds / xylan 1,4-beta-xylosidase [Arabidopsis thaliana]
RefSeqNP_197984.2036766674ASD2 (ALPHA-L-ARABINOFURANOSIDASE 2); alpha-N-arabinofuranosidase/ hydrolase, acting on glycosyl bonds [Arabidopsis thaliana]
RefSeqXP_002523672.103467035675Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L4e-1724465148474A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K4e-1724465148474A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J4e-1724465148474A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I4e-1724465148474A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H4e-1724465148474A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BX84131133113310
HO8526834142446530
HO7807404052726730
JG5770273331014330
BX841311373083440.9
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)