y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID483030
FamilyGH13
Protein PropertiesLength: 784 Molecular Weight: 89442.1 Isoelectric Point: 6.1652
ChromosomeChromosome/Scaffold: 4 Start: 19413991 End: 19420502
Descriptionisoamylase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132366220
  IEFPGTYQGVAEKLDHLKELGINCIELMPCHEFNELEYYSYNTILGDHRLNFWGYSTIGFFSPMIRYASASSNSFAGRAINEFKILVKEAHKRGIEVIMD
  VVLNHTAEGNEKGPIFSFRGVDNSVYYMLAPKGEFYNYSGCGNTFNCNHPVVRQFIVDCLRYWVTEMHVDGFRFDLGSIMSRSSSLWDAANVYGVDVEGD
  LLTTGTPISCPPVIDMISNDPILRGVKLIAEAWDAGGLYQVGMFPHWGIWSEWNGKFRDVVRQFIKGTDGFSGVFAECLCGSPNLYQGGRKPWNSINFIC
  AHDGFTLADLVTYNNKNNLANGEENNDGENHNYSWNCGEEGDFASISVKRLRKRQMRNFFVSLMVSQGVPMIYMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 784     Download
MDSIKCSSSF LHRTKLNILF SNHAFPKISA PNFKRLFRPI SISAKARRSS EAESIAVVEK    60
PLKSERFNVS NGLPSPFGAT VRDDGVNFSV YSTNSVSATI CLISLSDLRQ NKVTEEIQLD    120
PSRNRTGHVW HVFLKGDFKD MLYGYRFDGK FSPEEGHYYD SSNILLDPYA KAIISRDEFG    180
VLGPDENCWP QMASMVPTRD EEFDWEGDMH LKLPQKDLVI YEMHVRGFTR HESSKIEFPG    240
TYQGVAEKLD HLKELGINCI ELMPCHEFNE LEYYSYNTIL GDHRLNFWGY STIGFFSPMI    300
RYASASSNSF AGRAINEFKI LVKEAHKRGI EVIMDVVLNH TAEGNEKGPI FSFRGVDNSV    360
YYMLAPKGEF YNYSGCGNTF NCNHPVVRQF IVDCLRYWVT EMHVDGFRFD LGSIMSRSSS    420
LWDAANVYGV DVEGDLLTTG TPISCPPVID MISNDPILRG VKLIAEAWDA GGLYQVGMFP    480
HWGIWSEWNG KFRDVVRQFI KGTDGFSGVF AECLCGSPNL YQGGRKPWNS INFICAHDGF    540
TLADLVTYNN KNNLANGEEN NDGENHNYSW NCGEEGDFAS ISVKRLRKRQ MRNFFVSLMV    600
SQGVPMIYMG DEYGHTKGGN NNTYCHDNYM NYFRWDKKEE AHSDFFRFCR LLIKFRDECE    660
SLGLNDFPTA KRLQWHGLAP EIPNWSETSR FVAFSLVDSV KREIYVAFNT SHLATLVCLP    720
NRPGYRWEPF VDTSKPSPYD CITPDLPERE TAMKQYRHFL DANMYPMLSY SSIILLLSPI    780
EDT*                                                                 840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145101.0e-12369724697+
PRK03705PRK037051.0e-14772656603+
cd11326AmyAc_Glg_debranch0203656460+
COG1523PulA069749710+
TIGR02100glgX_debranch071738709+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ81835.10977921787isoamylase isoform 1 [Pisum sativum]
DDBJBAF52941.101678324791isoamylase-type starch-debranching enzyme 1 [Phaseolus vulgaris]
EMBLCBI40669.104278262807unnamed protein product [Vitis vinifera]
RefSeqNP_181522.1017821782ISA1 (ISOAMYLASE 1); alpha-amylase/ isoamylase [Arabidopsis thaliana]
RefSeqXP_002324659.104178351794predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B07273315685A Chain A, Apo Form Of A Mutant Of Glycogenin In Which Asp159 Is Replaced By Ser
PDB2vuy_A07273315685A Chain A, Apo Form Of A Mutant Of Glycogenin In Which Asp159 Is Replaced By Ser
PDB2vr5_B07273315685A Chain A, Apo Form Of A Mutant Of Glycogenin In Which Asp159 Is Replaced By Ser
PDB2vr5_A07273315685A Chain A, Apo Form Of A Mutant Of Glycogenin In Which Asp159 Is Replaced By Ser
PDB2vnc_B07273315685A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002352634797400
HO8002351103144230
HO800235514274770
HO4312284113587670
DW0655502914587470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)