Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 483480 |
Family | CBM43 |
Protein Properties | Length: 121 Molecular Weight: 13459.5 Isoelectric Point: 7.6297 |
Chromosome | Chromosome/Scaffold: 4 Start: 21335119 End: 21335945 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 34 | 114 | 4e-30 |
WCVAKPSTANERLQENINFACSKIDCQIILEGGACYLPDNLISRASVAMNLYYQAQGRHFWNCNFEGSGLIGITDPSYGSC |
Full Sequence |
---|
Protein Sequence Length: 121 Download |
MAKAQICLCF IIILYLWSEG NLMKVAKADR SGDWCVAKPS TANERLQENI NFACSKIDCQ 60 IILEGGACYL PDNLISRASV AMNLYYQAQG RHFWNCNFEG SGLIGITDPS YGSCIYQFRK 120 * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-17 | 34 | 102 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-33 | 34 | 116 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB64039.1 | 0 | 1 | 110 | 1 | 111 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
GenBank | AAT41831.1 | 0 | 4 | 120 | 3 | 120 | At2g43670 [Arabidopsis thaliana] |
RefSeq | NP_177973.4 | 9.80909e-45 | 1 | 117 | 1 | 115 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 0 | 1 | 120 | 1 | 121 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_973680.1 | 3e-37 | 1 | 120 | 1 | 123 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-24 | 23 | 116 | 2 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |