Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 48584.m000013 |
Family | GT4 |
Protein Properties | Length: 253 Molecular Weight: 27054.2 Isoelectric Point: 7.459 |
Chromosome | Chromosome/Scaffold: 48584 Start: 177 End: 938 |
Description | sulfoquinovosyldiacylglycerol 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT4 | 53 | 208 | 3.9e-35 |
RPPHILFVGRQVEKKGLEVLIRAMTRVREHFPEARVKVVGDGPLRARNEALAAELAAPVDFLGARSSEQVRRLMDECALFCLPSVVSATGDAEGLPISIL EAQAAGVPVVTSAVGGRDEGIVDGRTGFGFAERDHEALAGHLCRLLGDNALRDDMG |
Full Sequence |
---|
Protein Sequence Length: 253 Download |
MAADPRVSFI AVSEAVRQRA ITGYQLPADK IEKVFIGVDV TTFRPGPITP GARPPHILFV 60 GRQVEKKGLE VLIRAMTRVR EHFPEARVKV VGDGPLRARN EALAAELAAP VDFLGARSSE 120 QVRRLMDECA LFCLPSVVSA TGDAEGLPIS ILEAQAAGVP VVTSAVGGRD EGIVDGRTGF 180 GFAERDHEAL AGHLCRLLGD NALRDDMGRE ARALAMERFD IRVCGRLLEA LYARRAAGVT 240 TPPASAVVGD VRP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd03808 | GT1_cap1E_like | 3.0e-41 | 9 | 222 | 218 | + This family is most closely related to the GT1 family of glycosyltransferases. cap1E in Streptococcus pneumoniae is required for the synthesis of type 1 capsular polysaccharides. | ||
cd03798 | GT1_wlbH_like | 2.0e-44 | 10 | 223 | 222 | + This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS. | ||
cd03801 | GT1_YqgM_like | 2.0e-53 | 9 | 220 | 220 | + This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea. | ||
cd03799 | GT1_amsK_like | 1.0e-55 | 9 | 224 | 218 | + This is a family of GT1 glycosyltransferases found specifically in certain bacteria. amsK in Erwinia amylovora, has been reported to be involved in the biosynthesis of amylovoran, a exopolysaccharide acting as a virulence factor. | ||
cd05844 | GT1_like_7 | 4.0e-63 | 9 | 224 | 218 | + Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAB88839.1 | 0 | 1 | 232 | 164 | 393 | putative hexosyltransferase [Gluconacetobacter xylinus] |
RefSeq | XP_002539932.1 | 0 | 1 | 253 | 1 | 253 | glycosyltransferase, putative [Ricinus communis] |
RefSeq | YP_001602787.1 | 0 | 1 | 232 | 157 | 386 | putative colanic acid biosynthesis glycosyl transferase [Gluconacetobacter diazotrophicus PAl 5] |
RefSeq | YP_001981856.1 | 0 | 1 | 238 | 149 | 386 | glycosyl transferase, putative, gt4F [Cellvibrio japonicus Ueda107] |
RefSeq | YP_594162.1 | 8.40779e-45 | 9 | 234 | 151 | 375 | glycosyl transferase, group 1 [Deinococcus geothermalis DSM 11300] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3oka_B | 0.000000000003 | 37 | 200 | 171 | 344 | A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form) |
PDB | 3oka_A | 0.000000000003 | 37 | 200 | 171 | 344 | A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form) |
PDB | 3okp_A | 0.000000000003 | 37 | 200 | 171 | 344 | A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' In Complex With Gdp-Man (Triclinic Crystal Form) |
PDB | 3okc_A | 0.000000000003 | 37 | 200 | 171 | 344 | A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' Bound To Gdp (Orthorhombic Crystal Form) |
PDB | 2gek_A | 0.00000000005 | 10 | 232 | 165 | 380 | A Chain A, Crystal Structure Of Corynebacterium Glutamicum Pimb' Bound To Gdp (Orthorhombic Crystal Form) |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FL441658 | 138 | 27 | 162 | 0.000000000000001 |
DT746170 | 207 | 28 | 222 | 0.0000000000001 |
JG941626 | 208 | 28 | 223 | 0.0000000000001 |
DT749357 | 207 | 28 | 222 | 0.0000000000001 |
FN023843 | 173 | 55 | 224 | 0.0000000000001 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|