CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID487889
FamilyGH3
Protein PropertiesLength: 797 Molecular Weight: 87496.4 Isoelectric Point: 6.0276
ChromosomeChromosome/Scaffold: 6 Start: 4216382 End: 4219391
DescriptionGlycosyl hydrolase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH3743440
  ASVPRLGIPPYEWWSESLHGLADNGPGVSFNGSISAATSFPQVIVSAASFNRTLWYEIGSAVAVEARAMYNGGQAGLTFWAPNINLFRDPRWGRGQETPG
  EDPKVVSEYGVEFVRGFQEKKKRKVLKTRFGSDNVDDDARYDDDADGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFETCIKDGKA
  SCLMCSYNAVNGVPACAQGDLLQKARVEWGFDGYITSDCDAVATIFEYQGYTKSPEEAVADAIKAGVDINC
Full Sequence
Protein Sequence     Length: 797     Download
MNHQLTLISL VFFTSAIAET FKNLDSHPQF PCKPPHFSSY PFCNVSLSIK QRAISLVSLL    60
TLPEKIGQLS TTAASVPRLG IPPYEWWSES LHGLADNGPG VSFNGSISAA TSFPQVIVSA    120
ASFNRTLWYE IGSAVAVEAR AMYNGGQAGL TFWAPNINLF RDPRWGRGQE TPGEDPKVVS    180
EYGVEFVRGF QEKKKRKVLK TRFGSDNVDD DARYDDDADG KLMLSACCKH FTAYDLEKWG    240
NFTRYDFNAV VTEQDMEDTY QPPFETCIKD GKASCLMCSY NAVNGVPACA QGDLLQKARV    300
EWGFDGYITS DCDAVATIFE YQGYTKSPEE AVADAIKAGV DINCGTYMLR NTQSAIEQGK    360
VSEELVDRAL LNLFAVQLRL GLFDGDPRGG HYGKLGSNDI CSSDHRKLAL EAARQGIVLL    420
KNDYKLLPLN KNHVSSLAIV GPMANNISNM GGTYTGKPCQ RKTLFTELLE YVKKTSYASG    480
CSDVSCVSDT GFGEAVAIAK GADFVIVVAG LDLSQETEDK DRFSLSLPGK QKDLVSSVAA    540
VSKKPVILVL TGGGPVDVTF AKTDPRIGSI IWIGYPGETG GQALAEIIFG DFNPGGRLPI    600
TWYPESFADV PMSDMHMRAD SSRGYPGRTY RFYTGPQVYS FGTGLSYTKF DYKIISAPIR    660
LSLSELLPQQ SSHKKQLLQH GEEQLQYIQL DDVMVNSCES LRFNVRVNVR NTGEIDGSHV    720
LMLFSKMARV LSGVPEKQLI GFDRVHIRSN EMMETVFVID PCKYLSVAND VGKRVIPLGI    780
HALFLGDLQH SLSVEF* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01915Glyco_hydro_3_C3.0e-54417648237+
COG1472BglX2.0e-5771455394+
pfam00933Glyco_hydro_35.0e-6161369340+
PRK15098PRK150985.0e-78111761699+
PLN03080PLN0308001796797+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC41913.10627962732putative beta-xylosidase [Arabidopsis thaliana]
EMBLCBI25718.102679626768unnamed protein product [Vitis vinifera]
RefSeqNP_196618.1017961792glycosyl hydrolase family 3 protein [Arabidopsis thaliana]
RefSeqXP_002264031.102679626789PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299457.102679626779predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3u48_B011176191698A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
PDB3u48_A011176191698A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
PDB3u4a_B011176191698A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
PDB3u4a_A011176191698A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
PDB2x41_A5e-395165214605A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DK485459264162790
DK466911264162790
DK472496257162720
DV1617653112805900
EV1619862475517970
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00063.2Aquca_017_00063.1Aquca_014_00481.1Aquca_069_00035.1Aquca_003_00570.1
Aquca_014_00481.2Aquca_009_01003.1Aquca_033_00044.1Aquca_033_00043.1Aquca_011_00469.1
Aquca_068_00054.2Aquca_068_00054.1Aquca_093_00018.1Aquca_093_00013.1Aquca_069_00035.2
Aquca_093_00014.1Aquca_093_00019.1Aquca_047_00018.1Aquca_069_00063.1
Arabidopsis lyrata470222895698917917325518496670
318716
Arabidopsis thalianaAT1G02640.1AT3G19620.1AT1G78060.1AT5G49360.1AT5G09730.1
AT5G64570.1AT5G10560.1
Brachypodium distachyonBradi2g48457.1Bradi3g59020.1Bradi5g23470.1Bradi4g20240.1Bradi5g16557.1
Bradi4g16026.1Bradi4g20197.1Bradi4g27697.1Bradi2g11410.1
Brassica rapaBra033337Bra015636Bra024311Bra031912Bra020646
Bra037782Bra010038Bra004202Bra036143Bra009023
Bra022440
Carica papayaevm.model.supercontig_66.79evm.model.supercontig_18.25evm.model.supercontig_0.14evm.model.supercontig_106.54evm.model.supercontig_1071.2
evm.model.supercontig_489.8evm.model.supercontig_166.31evm.model.supercontig_166.29evm.model.supercontig_129.18evm.TU.contig_33237.2
Capsella rubellaCarubv10008371mCarubv10015075mCarubv10019845mCarubv10022420mCarubv10025920m
Carubv10025915mCarubv10000252mCarubv10008583m
Chlamydomonas reinhardtiig4372.t2g4372.t1
Citrus clementinaCiclev10027856mCiclev10000352mCiclev10000355mCiclev10018959mCiclev10004369m
Ciclev10024911mCiclev10018262mCiclev10014325mCiclev10018058mCiclev10014315m
Ciclev10017977m
Citrus sinensisorange1.1g003980morange1.1g007737morange1.1g004054morange1.1g008175morange1.1g004190m
orange1.1g003606morange1.1g038581morange1.1g047862morange1.1g040836morange1.1g003876m
orange1.1g006224morange1.1g014083morange1.1g006889morange1.1g006866morange1.1g006863m
orange1.1g010408morange1.1g047621morange1.1g007089morange1.1g005782m
Cucumis sativusCucsa.205100.1Cucsa.345770.1Cucsa.154540.1Cucsa.325260.1Cucsa.096780.1
Cucsa.047580.1Cucsa.103770.1Cucsa.345770.2
Eucalyptus grandisEucgr.F02441.1Eucgr.H04033.2Eucgr.H04033.1Eucgr.H01055.1Eucgr.G00649.1
Eucgr.G00651.1Eucgr.G00653.1Eucgr.G00650.1Eucgr.D00316.1Eucgr.I01067.1
Eucgr.B01815.1Eucgr.H02409.1Eucgr.G00654.1Eucgr.F02442.1
Fragaria vescamrna22107.1-v1.0-hybridmrna05562.1-v1.0-hybridmrna25563.1-v1.0-hybridmrna05164.1-v1.0-hybridmrna16059.1-v1.0-hybrid
mrna02314.1-v1.0-hybridmrna16004.1-v1.0-hybridmrna30561.1-v1.0-hybrid
Glycine maxGlyma20g27011.1Glyma10g01710.1Glyma13g01950.1Glyma03g37710.1Glyma02g01660.1
Glyma19g40300.1Glyma14g34480.1Glyma06g11040.1Glyma09g33580.1Glyma09g04337.2
Glyma09g04337.1Glyma08g19280.1Glyma15g05720.1Glyma08g07950.1Glyma15g15370.2
Glyma15g15370.1Glyma05g24811.1Glyma19g40300.2
Gossypium raimondiiGorai.005G093200.2Gorai.005G093200.1Gorai.009G239100.1Gorai.005G093300.1Gorai.012G147500.1
Gorai.008G140600.1Gorai.002G219200.1Gorai.002G219200.2Gorai.012G140300.1Gorai.007G230000.1
Gorai.009G282000.2Gorai.009G282000.1Gorai.001G143600.1Gorai.002G219100.1Gorai.005G218000.1
Gorai.011G198200.1Gorai.006G259500.2Gorai.006G259500.1Gorai.005G218000.3Gorai.009G282000.3
Gorai.002G219200.3
Linum usitatissimumLus10022374Lus10019099Lus10010015Lus10020966Lus10004271
Lus10016858Lus10007775Lus10037728
Malus domesticaMDP0000608429MDP0000298527MDP0000174676MDP0000121374MDP0000450710
MDP0000156778MDP0000162509MDP0000140483MDP0000197977MDP0000697764
MDP0000231809MDP0000200256MDP0000191417MDP0000407622MDP0000165135
MDP0000174004MDP0000321928MDP0000220923MDP0000156321MDP0000156045
MDP0000287981MDP0000268143
Manihot esculentacassava4.1_032291mcassava4.1_025638mcassava4.1_002149mcassava4.1_033980mcassava4.1_002121m
cassava4.1_031387mcassava4.1_002077mcassava4.1_001960mcassava4.1_022073mcassava4.1_003704m
Medicago truncatulaCU651566_10.1Medtr1g106860.1Medtr1g087240.1Medtr7g109390.1Medtr5g062430.1
Medtr5g062650.1Medtr5g062320.1Medtr5g030860.1Medtr2g034720.1Medtr2g008240.1
Medtr5g062370.1Medtr5g062570.1
Mimulus guttatusmgv1a001688mmgv1a001753mmgv1a001417mmgv1a001636mmgv1a001678m
mgv1a018879mmgv1a019840mmgv1a001695mmgv1a021704mmgv1a025071m
mgv1a018779mmgv1a001598mmgv1a001738mmgv1a001685mmgv1a020334m
mgv1a001665mmgv1a001709mmgv1a002957mmgv1a018473mmgv1a001559m
mgv1a001867mmgv1a002689mmgv1a002754mmgv1a024762mmgv1a004253m
mgv1a020757m
Oryza sativaLOC_Os02g51620.1LOC_Os11g44950.2LOC_Os11g19210.1LOC_Os04g54810.1LOC_Os11g19160.1
LOC_Os04g44840.1LOC_Os11g18730.1LOC_Os01g19220.1LOC_Os11g18690.1LOC_Os11g47350.1
LOC_Os11g44950.1
Panicum virgatumPavirv00047686mPavirv00033556mPavirv00024100mPavirv00036845mPavirv00061381m
Pavirv00008674mPavirv00037692mPavirv00015197mPavirv00015196mPavirv00016759m
Pavirv00066354mPavirv00035440mPavirv00005511mPavirv00036846mPavirv00046032m
Pavirv00012516mPavirv00024941mPavirv00018921m
Physcomitrella patensPp1s196_21V6.2Pp1s196_21V6.1Pp1s406_3V6.1Pp1s8031_1V6.1
Phaseolus vulgarisPhvul.009G029300.1Phvul.008G153300.1Phvul.009G254300.1Phvul.001G212100.1Phvul.002G206800.1
Phvul.007G215100.1Phvul.006G208200.1Phvul.002G142900.1
Picea abiesMA_99945g0010MA_4577g0010MA_182289g0010MA_102349g0010MA_10426142g0010
MA_140124g0010MA_249055g0010MA_77922g0010MA_102783g0010MA_261256g0010
MA_10436568g0020MA_161425g0010MA_180495g0010MA_7037g0010MA_791061g0010
MA_39151g0010MA_208144g0010MA_10391505g0010MA_174653g0010MA_2210771g0010
MA_10430067g0010.144.215MA_10430067g0010.144.215
Populus trichocarpaPotri.001G294700.1Potri.005G168500.1Potri.002G197200.1Potri.002G093900.1Potri.002G094000.4
Potri.002G094000.3Potri.002G094000.2Potri.002G094000.1Potri.001G206800.2Potri.014G122200.1
Potri.010G141400.2Potri.010G141400.1Potri.001G089100.1Potri.002G093900.2Potri.001G089100.2
Potri.001G206800.1Potri.003G022900.1Potri.008G108100.1Potri.005G168400.1Potri.014G122200.2
Potri.007G114300.1Potri.001G354200.1Potri.003G022900.2Potri.014G122200.3Potri.002G094000.5
Potri.001G089100.3Potri.009G088800.1
Prunus persicappa015037mppa001583mppa001656mppa001675mppa001718m
ppa001692mppa023763m
Ricinus communis28152.m00091730076.m00467529889.m00326530221.m00222229908.m006002
28333.m00055529693.m00204529908.m00599740979.m00001330381.m000024
28740.m00002833434.m00001435902.m000018
Setaria italicaSi016356mSi009432mSi027450mSi009427mSi026003m
Si026007mSi000314mSi028069mSi026099m
Selaginella moellendorffii10303880102112087419541
Sorghum bicolorSb04g027700.1Sb05g026400.1Sb06g030270.1Sb0010s012040.1Sb06g023450.1
Sb0010s010920.1Sb0010s007570.1Sb03g012290.1Sb10g020500.1
Thellungiella halophilaThhalv10022061mThhalv10006876mThhalv10018160mThhalv10003681mThhalv10003678m
Thhalv10012739mThhalv10012725m
Vitis viniferaGSVIVT01028104001GSVIVT01009003001.744.996GSVIVT01009003001.744.996GSVIVT01009003001.76.329GSVIVT01009003001.76.329
GSVIVT01037844001GSVIVT01013328001GSVIVT01022541001GSVIVT01006776001GSVIVT01035033001
GSVIVT01017659001GSVIVT01017658001GSVIVT01017660001GSVIVT01013347001GSVIVT01029802001
GSVIVT01021413001GSVIVT01017656001GSVIVT01020198001
Zea maysAC234091.1_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)