| Basic Information | |
|---|---|
| Species | Selaginella moellendorffii |
| Cazyme ID | 49485 |
| Family | GT1 |
| Protein Properties | Length: 178 Molecular Weight: 19975.8 Isoelectric Point: 5.8658 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 4 | 177 | 1.5e-33 |
| DWLDTQEPDSVLYVAFGSIAKLSQEEFEELALGLEASKVPFLLTVRPPQFVDEGDTTVLVKNSDFYKNFVERTKGRGLVVSWAPQREVLAHRALAGFVSH CGWNSVLESVSSGVPIICWPRIYEQGLNRKIMAERCRIGVEVSDGRSSDAFVKREEIAEAIARIFSDKARKARA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 178 Download |
| ECLDWLDTQE PDSVLYVAFG SIAKLSQEEF EELALGLEAS KVPFLLTVRP PQFVDEGDTT 60 VLVKNSDFYK NFVERTKGRG LVVSWAPQRE VLAHRALAGF VSHCGWNSVL ESVSSGVPII 120 CWPRIYEQGL NRKIMAERCR IGVEVSDGRS SDAFVKREEI AEAIARIFSD KARKARAR 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02448 | PLN02448 | 2.0e-34 | 1 | 178 | 181 | + UDP-glycosyltransferase family protein | ||
| PLN03007 | PLN03007 | 1.0e-35 | 1 | 178 | 186 | + UDP-glucosyltransferase family protein | ||
| PLN00164 | PLN00164 | 9.0e-36 | 1 | 178 | 182 | + glucosyltransferase; Provisional | ||
| PLN02534 | PLN02534 | 4.0e-36 | 1 | 178 | 192 | + UDP-glycosyltransferase | ||
| PLN02555 | PLN02555 | 6.0e-41 | 1 | 162 | 162 | + limonoid glucosyltransferase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAY75738.1 | 3.00004e-41 | 1 | 176 | 257 | 439 | hypothetical protein OsI_03650 [Oryza sativa Indica Group] |
| RefSeq | XP_001760897.1 | 1.99993e-41 | 2 | 176 | 279 | 444 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002324098.1 | 1.99965e-42 | 2 | 177 | 259 | 424 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002526107.1 | 1.99993e-41 | 2 | 177 | 258 | 422 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| RefSeq | XP_002526109.1 | 4.99983e-42 | 2 | 177 | 215 | 379 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 3e-38 | 1 | 175 | 257 | 434 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2vch_A | 3e-38 | 1 | 175 | 257 | 434 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2vce_A | 3e-38 | 1 | 175 | 257 | 434 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2pq6_A | 8e-38 | 1 | 178 | 284 | 448 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c9z_A | 2e-33 | 2 | 148 | 261 | 395 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| anthocyanin biosynthesis (delphinidin 3-O-glucoside) | RXN-7815 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | PELUDP-RXN | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FE428804 | 178 | 1 | 178 | 0 |
| FE451402 | 175 | 4 | 178 | 0 |
| FE480333 | 172 | 7 | 178 | 0 |
| FE480334 | 172 | 7 | 178 | 0 |
| FE501737 | 167 | 12 | 178 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Selaginella moellendorffii | 27279 | 16568 | 27278 | 37475 | 26771 |
| 18145 | 111307 | 23005 | 113943 | 12792 | |
| 445219 | 35644 | 12509 | 427660 | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |