Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 56962.m000054 |
Family | GH100 |
Protein Properties | Length: 104 Molecular Weight: 11849.7 Isoelectric Point: 10.5513 |
Chromosome | Chromosome/Scaffold: 56962 Start: 4419 End: 4785 |
Description | cytosolic invertase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH100 | 1 | 101 | 0 |
MPLKITYPALEGHQWRIVTGCDPKNTRWSYHNGGSWPVLLRLLTAACIKTGRPTISKRAIELVEQRLSKDGWQESYDGKTGRYIGKQARKYQTWSIAGFG L |
Full Sequence |
---|
Protein Sequence Length: 104 Download |
MPLKITYPAL EGHQWRIVTG CDPKNTRWSY HNGGSWPVLL RLLTAACIKT GRPTISKRAI 60 ELVEQRLSKD GWQESYDGKT GRYIGKQARK YQTWSIAGFG LVKN |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam11701 | UNC45-central | 0.005 | 37 | 65 | 30 | + Myosin-binding striated muscle assembly central. The UNC-45 or small muscle protein 1 of C.elegans is expressed in two forms from different genomic positions in mammals, as a general tissue protein UNC-45a and a specific form Unc-45b expressed only in striated and skeletal muscle. All members carry up to three amino-terminal tetratricopeptide repeat (TPR) domains towards their N-terminal, a UCS domain at the C-terminal that contains a number of Arm repeats pfam00514 and this central region of approximately 400 residues. Both the general form and the muscle form of UNC-45 function in myotube formation through cell fusion. Myofibril formation requires both GC and SM UNC-45, consistent with the fact that the cytoskeleton is necessary for the development and maintenance of organised myofibrils. The S. pombe Rng3p, is crucial for cell shape, normal actin cytoskeleton, and contractile ring assembly, and is essential for assembly of the myosin II-containing progenitors of the contractile ring. Widespread defects in the cytoskeleton are found in null mutants of all three fungal proteins. Mammalian Unc45 is found to act as a specific chaperone during the folding of myosin and the assembly of striated muscle by forming a stable complex with the general chaperone Hsp90. The exact function of this central region is not known. |
PLN02703 | PLN02703 | 2.0e-48 | 1 | 103 | 103 | + beta-fructofuranosidase |
PLN02973 | PLN02973 | 4.0e-55 | 1 | 103 | 103 | + beta-fructofuranosidase |
PLN03005 | PLN03005 | 3.0e-57 | 1 | 103 | 103 | + beta-fructofuranosidase |
pfam12899 | Glyco_hydro_100 | 9.0e-66 | 1 | 103 | 103 | + Alkaline and neutral invertase. This is a family of bacterial and plant alkaline and neutral invertases, EC:3.2.1.26, previously known as Invertase_neut pfam04853. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAV28816.1 | 0 | 1 | 103 | 28 | 130 | neutral/alkaline invertase 8 [Oryza sativa Indica Group] |
GenBank | AAZ80874.1 | 0 | 1 | 103 | 41 | 143 | neutral invertase [Nicotiana langsdorffii x Nicotiana sanderae] |
RefSeq | XP_002301418.1 | 0 | 1 | 103 | 334 | 436 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002525039.1 | 0 | 1 | 103 | 563 | 665 | beta-fructofuranosidase, putative [Ricinus communis] |
RefSeq | XP_002534728.1 | 0 | 1 | 104 | 1 | 104 | conserved hypothetical protein [Ricinus communis] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GE471995 | 103 | 1 | 103 | 0 |
DT596693 | 103 | 1 | 103 | 0 |
FN710011 | 103 | 1 | 103 | 0 |
DV993990 | 103 | 1 | 103 | 0 |
CK444157 | 103 | 1 | 103 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |