Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 59437.m00005 |
Family | GH35 |
Protein Properties | Length: 91 Molecular Weight: 10561.1 Isoelectric Point: 5.5955 |
Chromosome | Chromosome/Scaffold: 59437 Start: 151 End: 498 |
Description | Glycosyl hydrolase family 35 protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 15 | 87 | 1.7e-36 |
SVQMWPSLIGKAKEGGLDVIQTYVFWNLHEPQPGQYDFSGRYDLVKFVKEIQAQGLYVCLRIGPFIESEWTYG |
Full Sequence |
---|
Protein Sequence Length: 91 Download |
VIWNTNLILS GFNFSVQMWP SLIGKAKEGG LDVIQTYVFW NLHEPQPGQY DFSGRYDLVK 60 FVKEIQAQGL YVCLRIGPFI ESEWTYGYVI H |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam02449 | Glyco_hydro_42 | 2.0e-6 | 19 | 75 | 58 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. |
COG1874 | LacA | 8.0e-10 | 18 | 84 | 69 | + Beta-galactosidase [Carbohydrate transport and metabolism] |
PLN03059 | PLN03059 | 3.0e-32 | 17 | 87 | 71 | + beta-galactosidase; Provisional |
pfam01301 | Glyco_hydro_35 | 7.0e-40 | 17 | 87 | 71 | + Glycosyl hydrolases family 35. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN82672.1 | 3e-37 | 17 | 87 | 55 | 125 | hypothetical protein [Vitis vinifera] |
EMBL | CBI21611.1 | 2e-37 | 17 | 87 | 55 | 125 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002274012.1 | 3e-37 | 17 | 87 | 91 | 161 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002307056.1 | 1e-37 | 17 | 87 | 54 | 124 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002537886.1 | 0 | 1 | 91 | 1 | 91 | beta-galactosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3d3a_A | 0.000000000000009 | 17 | 87 | 37 | 107 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_D | 0.00000000000004 | 19 | 87 | 42 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_C | 0.00000000000004 | 19 | 87 | 42 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_B | 0.00000000000004 | 19 | 87 | 42 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_A | 0.00000000000004 | 19 | 87 | 42 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BU826829 | 71 | 17 | 87 | 5e-40 |
DB892822 | 71 | 17 | 87 | 3e-39 |
BE354524 | 71 | 17 | 87 | 3e-37 |
AM058531 | 71 | 17 | 87 | 1e-36 |
BE354527 | 70 | 18 | 87 | 2e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |